Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6223 Phosphoribosyl-ATP cyclohydrolase (hisE) 
MHDMSNEIVDELYKIILDRIEKRPTGSYTAEIVNKGKPYVARKVGEESVETIVASLAENKERFISEVADLIYHLLVLMAL
EGVTPEDIYRELERRRK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897515 Gene name: hisE COG: E COG0140 Phosphoribosyl-ATP pyrophosphohydrolase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6223 hypothetical 1 hisE Phosphoribosyl-ATP cyclohydrolase Amino Acid Biosynthesis 1 single function 3.6.1.39 04/22/01 00:00:00 terminal status:good E COG0140 Amino acid transport and metabolism Phosphoribosyl-ATP pyrophosphohydrolase

CROSS REFERENCES:
pI: 5,1
MW: 11235,81
GenBank: 13813764