Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6264 hypothetical protein SSO6264 
MKYYVELIIINKDSVRDPEGETIQKYVIEKYTNNIIETRVGKYIQFKIEANNEEDAKNLIEKIANEGRLYNPIIHKILVR
VRRE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897543 Gene name: - COG: F COG1828 Phosphoribosylformylglycinamidine (FGAM) synthase, PurS component Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6264 hypothetical 1 Conserved hypothetical protein 1 single function Related to uncharacterized ACR, YexA/UPF0062 family. Similarity with TM1244 and MJ1593 04/22/01 00:00:00 terminal status:suspect: LH S COG1828 Function unknown Uncharacterized ACR, YexA/UPF0062 family

CROSS REFERENCES:
pI: 9,06
MW: 10038,5
GenBank: 13813796