Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6418 50S ribosomal protein L37 
MTIMGKVTGISGRFGARYGSTLRKKWKEIMEKRYDEHQCPYCKTTGKVIRLASGIWYCKKCNSKWAGLAYTPY

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897634 Gene name: rpl37AE COG: J COG1997 Ribosomal protein L37AE/L43A Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6418 hypothetical 1 rpl37AE LSU ribosomal protein L37AE Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG1997 Translation, ribosomal structure and biogenesis Ribosomal protein L37AE

CROSS REFERENCES:
pI: 10,62
MW: 8446,91
GenBank: 13813901