Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6453 50S ribosomal protein L37 
MKGTPSFGKMNKSHTHIRCRRCGRNAYNVSKHYCAACGFGRTKKIRRYSWQNKKVNGVRIR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897657 Gene name: rpl37E COG: J COG2126 Ribosomal protein L37E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6453 hypothetical 1 rpl37E LSU ribosomal protein L37E Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG2126 Translation, ribosomal structure and biogenesis Ribosomal protein L37E

CROSS REFERENCES:
pI: 11,91
MW: 7145,35
GenBank: 13813926