Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6503 hypothetical protein SSO6503 
MSMPYDNEAKIKQAVILLQKIVNDTSVPRNIRRAATDAIRNLQDLGLSPAVRAANAIGILEDISQDPNMPTHARISIWNV
VSILETVKD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897684 Gene name: - COG: S COG1698 Uncharacterized protein conserved in archaea Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6503 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:good S COG1698 Function unknown Uncharacterized ArCR

CROSS REFERENCES:
pI: 7,53
MW: 9820,2
GenBank: 13813957
SCOP superfamily: => 
SCOP assignment: 17-89 1.3e-02 ARM repeat