Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6768 DNA-directed RNA polymerase subunit K 
MGLERDEILSQDLHFNEVFISLWQNRLTRYEIARVISARALQLAMGAPALIDINNLSSTDVISIAEEEFRRGVLPITIRR
RLPNGKIILLSLRKS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897794 Gene name: rpoK COG: K COG1758 DNA-directed RNA polymerase, subunit K/omega Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6768 hypothetical 1 rpoK DNA-directed RNA Polymerase subunit K Transcription 1 single function 2.7.7.6 RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG1919 Transcription DNA-directed RNA polymerase subunit K, RpoK/RPB6

CROSS REFERENCES:
pI: 10,48
MW: 10857,5
GenBank: 13814087
SCOP superfamily: => 
SCOP assignment: 22-94 2.4e-20 HRPABC14.4, essential subunit of RNA polymerases I, II and III (RPB6)