Sulfolobus solfataricus P2 >SSO6768 DNA-directed RNA polymerase subunit K MGLERDEILSQDLHFNEVFISLWQNRLTRYEIARVISARALQLAMGAPALIDINNLSSTDVISIAEEEFRRGVLPITIRR RLPNGKIILLSLRKS15897794 Gene name: rpoK COG: K COG1758 DNA-directed RNA polymerase, subunit K/omega Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2 __________
|
|
CROSS REFERENCES: pI: 10,48 MW: 10857,5 GenBank: 13814087 SCOP superfamily: => SCOP assignment: 22-94 2.4e-20 HRPABC14.4, essential subunit of RNA polymerases I, II and III (RPB6)