Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO7412 Pyruvate synthase delta chain (Pyruvic-ferredoxin oxidoreductase delta chain) (porD-1) 
MIKVPIGVPVARPKIGSAGKTGLWRVEKPVISYDKCTKCRLCVLYCLENTIDLLENLYPQIDYDYCKGCGVCAQVCPPKA
IDMVREVK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898060 Gene name: porD-1 COG: C COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO7412 hypothetical 1 porD-1 Pyruvate synthase delta chain (Pyruvic-ferredoxin oxidoreductase delta chain) Energy Metabolism 1 single function 1.2.7.1 04/22/01 00:00:00 terminal status:check: MH C COG1144 Energy production and conversion Ferredoxin-like subunits of formate hydrogenlyase

CROSS REFERENCES:
pI: 8,22
MW: 9821,68
GenBank: 13814403
SCOP superfamily: => 
SCOP assignment: 16-84 5.6e-12 4Fe-4S ferredoxins