Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO8124 DNA polymerase II (DNA polymerase B2) amino-end (dpo2) 
MGRTQPSYTMAVNRELEKLERIIERLHSPILSLLLERVKEKVRYTQSASYDELVDPYNLVYFALIWALAEECEKWRSTYL
TLIQSREE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898292 Gene name: dpo2 COG: Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO8124 hypothetical 1 dpo2 DNA polymerase II (DNA polymerase B2) amino-end Replication and Repair 1 single function 2.7.7.7 Putative frameshift with SSO1459 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 5,31
MW: 10524,97
GenBank: 13814685