Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO8813 hypothetical protein SSO8813 
MRLFTLSKKKYNVKFEDTIDFLDKIILPYTIILPINSHDYEKAKGIMISKTLKPSDAFHVAVMINNSIKKIVSEDSDFDK
INGIERIWVK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898541 Gene name: - COG: R COG1848 Predicted nucleic acid-binding protein, contains PIN domain Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO8813 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with Carboxy-end of PAB0859, PAB1216, AF0065 04/22/01 00:00:00 terminal status:suspect: LH T COG1848 Signal transduction mechanisms Archaeal proteins containing PIN domain

CROSS REFERENCES:
pI: 9,98
MW: 10475,22
GenBank: 13814982