Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO8869 Ferredoxin (Amino-end fragment) (zfx-2) 
MGIDPNYRQSRQVVGEHEGHKIYGPVDEPKVLGVHGTIVGVDFDVCIADGS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898564 Gene name: zfx-2 COG: C COG1146 Ferredoxin Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO8869 hypothetical 1 Ferredoxin (Amino-end fragment) Energy Metabolism 1 single function Protein probably interrupted by multiple insertion elements. Carboxy-end is SSO8958 Electron transport 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 4,89
MW: 5492,14
GenBank: 13815009