Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO9043 Transposase, putative amino-end fragment 
MPKYLRSTLVDEDVEYTKEILRSIAEELSCKIISLEVMPNHIHLFVNCPSRYVPSYLAKTTLRLLVTVQINMGTRGMG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898637 Gene name: - COG: L COG1943 Transposase and inactivated derivatives Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO9043 hypothetical 1 Transposase, putative amino-end fragment Uncategorized 1 single function Similar to TM1832, TM0777. Complete protein is SS1474 04/22/01 00:00:00 terminal status:suspect: LH L COG1943 DNA replication, recombination and repair Predicted transposase

CROSS REFERENCES:
pI: 8,1
MW: 8927,44
GenBank: 13815094