Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO9270 Second ORF in partial transposon ISC1913 
MFYIRSVDIILITYKDRLTRFGFEYLEEFFSTMGVRIEVVLGEEPKDATQELVEDLISIITSFAGKIYGIRSHKKTVLVQ
GVKKLIGELSGEDSEVKG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898726 Gene name: - COG: L COG2452 Predicted site-specific integrase-resolvase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO9270 hypothetical 1 second ORF in partial transposon ISC1913 1 single function ISC1913 is split by ISC1190 (SSO1926) the first ORF is SSO1927 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 5,01
MW: 11135,81
GenBank: 13815199
SCOP superfamily: => 
SCOP assignment: 3-74 3.5e-06 Resolvase-like