Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO9378 hypothetical protein SSO9378 
MSLTLRVEVGKKGYIIIPKSVRDLVGIKEGDILILTVVGDKIILEPERKVNIREVVKKLEEHERKISYAKRASLGELENI
SLEEELKIDFS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898765 Gene name: - COG: K COG2002 Regulators of stationary/sporulation gene expression Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO9378 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with AF2011 04/22/01 00:00:00 terminal status:suspect: LH K COG2002 Transcription Regulators of stationary/sporulation gene expression

CROSS REFERENCES:
pI: 7,53
MW: 10372,11
GenBank: 13815244