SSO0166

Coordinates:137128-138063

>SSO0166 UDP-glucose 4-epimerase (galE-2)
MYIVTGGAGYIGGHLVDYLISKNLEVIVIDDLSYGKYRNEKAKFVMFDLRQNMGELVEKLEKNPIIYHLAANPDVRTSMI
NVEEHFERDVKVTLNVMELARRVDAEKVIFTSSSTVYGETSKIPTPESEELKPISNYGLFKLLCENIVKYYAEQYGIKSI
STRLANITGGRVSHGVVIDFIKKLKDNPNLLEILGNGKQRKSYLYIDDLIEAFVMLEKKVNRIYDVFNIGNNDSITVDEI
AKIVIDEMKLSPRITYKNPTADGRGWPGDVRLMLLDISKISREVGWSPKMSSREVIRQAVKDLLYGYKSVY

>SSO0166 UDP-glucose 4-epimerase (galE-2)
ATGTACATAGTTACAGGTGGTGCTGGTTACATAGGTGGACATCTAGTCGATTATTTAATTTCAAAAAATTTAGAAGTAAT
AGTTATTGATGATTTATCTTATGGCAAATACAGAAATGAGAAGGCTAAATTTGTAATGTTTGACTTACGTCAAAACATGG
GAGAACTAGTAGAGAAACTAGAAAAAAATCCGATAATTTACCATTTAGCTGCAAATCCAGACGTAAGAACGTCTATGATA
AATGTGGAGGAGCATTTCGAAAGGGATGTCAAAGTCACGTTAAATGTAATGGAACTAGCAAGGAGAGTAGATGCAGAAAA
AGTAATCTTTACCTCATCATCTACTGTCTATGGAGAGACAAGTAAGATTCCAACTCCAGAATCAGAAGAACTTAAGCCAA
TTTCCAATTACGGATTATTTAAACTATTATGTGAGAATATAGTAAAATATTACGCAGAGCAATATGGCATAAAAAGTATC
AGCACAAGATTAGCAAACATAACTGGTGGCAGAGTAAGCCATGGAGTAGTAATTGACTTTATAAAAAAGCTTAAAGATAA
TCCAAATTTACTAGAGATCTTAGGAAATGGAAAACAAAGAAAAAGTTATCTGTATATCGATGATTTAATAGAGGCGTTCG
TAATGTTAGAGAAAAAAGTAAACCGGATTTATGACGTTTTTAACATAGGTAATAATGATTCAATTACTGTAGACGAGATT
GCTAAGATTGTTATAGATGAAATGAAATTAAGTCCAAGAATCACTTATAAGAATCCGACAGCTGATGGAAGAGGGTGGCC
AGGAGACGTAAGATTAATGTTATTAGATATCTCAAAAATATCAAGGGAAGTAGGCTGGTCACCCAAAATGAGTTCCAGAG
AAGTGATTAGACAAGCCGTAAAAGATTTGTTATATGGTTACAAGTCAGTCTATTGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 136628 - 138563 (Additional range around SSO0166 is :500nt.)

>Sulfolobus solfataricus P2 GATTCTTGAGATCTTAGAAACACCAGCAAACAAAGAATTGGCTAGAAGAGGAATAATAATAAGAGGAGCTAAAATTAGGA CTGAGGCAGGATTAGCTGTAGTTACGTCTAGACCAGGACAAGATGGAGTAATAAATGCGGTGCTCTTAAAGAATGAGTCT CAGAGATCTTAAAGAAGAAAACAGAATAGTTATCTGGCCTTCATATTTTTTCTCACCAACTAGGTCTAAGGGAAGACGGC TGGCTAGGATACCGTATAAAATAAAAACCGAAGAATTAGTTTCAACACTTAGGGAACTTGGTCTAGATCCGATAGTTATA GAAAATAAAAAATATCCTAGAGATAGAAAGATTAATTTTTTGATAGCGGTAAAGAAAGTTAAAAGTAAAAATTACACGTT AAAAATAATACACAACGCACTTATGGGAACGAGACAAACTAATCCTAATAAAAGTAATTAAGAACATCAAGTTTAATAAA GGAATCCATTTCCATTACAT ATGTACATAGTTACAGGTGGTGCTGGTTACATAGGTGGACATCTAGTCGATTATTTAAT TTCAAAAAATTTAGAAGTAATAGTTATTGATGATTTATCTTATGGCAAATACAGAAATGAGAAGGCTAAATTTGTAATGT TTGACTTACGTCAAAACATGGGAGAACTAGTAGAGAAACTAGAAAAAAATCCGATAATTTACCATTTAGCTGCAAATCCA GACGTAAGAACGTCTATGATAAATGTGGAGGAGCATTTCGAAAGGGATGTCAAAGTCACGTTAAATGTAATGGAACTAGC AAGGAGAGTAGATGCAGAAAAAGTAATCTTTACCTCATCATCTACTGTCTATGGAGAGACAAGTAAGATTCCAACTCCAG AATCAGAAGAACTTAAGCCAATTTCCAATTACGGATTATTTAAACTATTATGTGAGAATATAGTAAAATATTACGCAGAG CAATATGGCATAAAAAGTATCAGCACAAGATTAGCAAACATAACTGGTGGCAGAGTAAGCCATGGAGTAGTAATTGACTT TATAAAAAAGCTTAAAGATAATCCAAATTTACTAGAGATCTTAGGAAATGGAAAACAAAGAAAAAGTTATCTGTATATCG ATGATTTAATAGAGGCGTTCGTAATGTTAGAGAAAAAAGTAAACCGGATTTATGACGTTTTTAACATAGGTAATAATGAT TCAATTACTGTAGACGAGATTGCTAAGATTGTTATAGATGAAATGAAATTAAGTCCAAGAATCACTTATAAGAATCCGAC AGCTGATGGAAGAGGGTGGCCAGGAGACGTAAGATTAATGTTATTAGATATCTCAAAAATATCAAGGGAAGTAGGCTGGT CACCCAAAATGAGTTCCAGAGAAGTGATTAGACAAGCCGTAAAAGATTTGTTATATGGTTACAAGTCAGTCTATTGA TA GATATGCTTCCTAATATCTCTCATCAATTTTAAGGAATATGTGAAAGTTATGTGAGAAGAAAATAAAAAATAAATTACTA TAAATATTATTTTATGATCGAAAAGTAAGTAATATGCGGATAGTAAAAATAATTTTGAAAAATCAACATTATATTATGGT CATGGACATTATATGTATCTAATCCTCTTGACTATAAACTCAAACTCTGAACCTGTCAGGAAAAAGCCTTTAATGAGTGA ACTGAGTGAGAATGTCTAACTAATTTTTTAAGGAAATTTGATGCGCGGGCCCGCCGGGATTCGAACCCGGGACTACGGGT ATCTCCGCTTTTCTTACATGGTTAAGAGCCCGTCGCTCTACCTGGCTAAGCTACGGGCCCAACAATAAAAACTACTTTAA ATAATATATAAAGTAAACGGTTTCTGACTATTTAATCTATGACTATACGTGTGTCACATAGACTTATTATATCCTTATCA TGAGTAGCCAGAATTAA