SSO0328

Coordinates:279779-283225

>SSO0328 NADH dehydrogenase subunit L (NuoL)
MHLRLLYFTIGKRINWRWNKMFPLSFIMLIISFILAVSIFFVRSRVASFILSFVSIAINIPFLVFRGIFENIFVSKYVGD
FGIVVNNFNYPFIITIIIITLLSAIYSLRYMEHKFDEERKSSWGLYYALYTLFALSMLYTVLSTNLLELYIFLEISLISS
FLLIALYGYGDRRRISLMYFIWTHIGTILLLASIIVIGLSTGSMNIYVDAYTFANYSTISYGILVFIIAVVGMFVKGAQA
GFNIWLPYAHGEAPTPISVLLSPNMVGLGIFVVIIYYYLFPTMSFLAPIFIAWAIITMIYGGINALAQKDFKRFLAYSSV
SQMGYMLLGASIAFLSGLSNSIISLPIGILASILIYVSHGFGKAILFMSAGASITELNERNIEKLGGLYLSSPLHSTLAF
IGALNLLGLPPTIGLISEALLIFSLGTILDKIGIVGFIVIVAFIMIAIGTSSAYIGYLFKTVYAGKKETKNIDNVKEYSI
PMLLIGIFSIITFFIPQYVSPSLVFTSLFSNSTILPFIAFLPVLGSLIALITPKSLNQDLRGAIVVVSIGISMVLSAVLL
VNNLGKPLFGHPQLSYSFGYLQFSANLLQSILALFVSSLSFFIALYSIGYMREDNVLRRYWGFFGLFVTSMLSVVLANNV
LLFIAGWEGTSLASYGLISYWLDDNERNVVGDFGRRIFGIENVSKPTTSGIRALIFTRVGDVGLLAVLGYLLSLSSYNYI
LYPISNVSSTVFSALYAVASHPEGWLILLIFFLGGLAKSAQFPFTQWLLTAMTGPTPVSALIHAATMVNLGAILTFLTYQ
FIPINSNTYLFFAIMVGITLFTALYTSINALASNEQKVILAYSTADQISLMIFSSSLGALLGNVSLGIIIGLIQMFAHGL
YKASLFMNAGSVIHYTESRYVASKPLLYKEIPSVFILQLIAALNLANLPPLIGFWAHNIIGNLASSTSTTIFYLYIILEF
LGSIYILRYIARTFLWKGETDKTHEHGHLSILMVISPAFLILGSIILGVLYFNLATFFNIIQFSEIDFLSLTLSIIGWII
AFAIYTRYLNLSSVKPLIDFVYYGWYVNPAFDKFGYLFKDFAGALFKNFERGVIDLGLNERLPKSIVNFGSRIYNVVEDH
ILGDYIMLYAWGIVLLLIIVLILFGVIG

>SSO0328 NADH dehydrogenase subunit L (NuoL)
TTGCATTTGCGGCTGTTATACTTTACTATAGGCAAAAGGATAAACTGGAGGTGGAATAAGATGTTTCCTCTCTCCTTTAT
AATGTTAATAATATCCTTTATACTTGCAGTTAGTATATTTTTTGTTAGATCAAGAGTAGCCTCATTTATTTTGAGTTTTG
TATCAATAGCCATAAATATCCCATTTTTGGTTTTTAGAGGTATTTTTGAAAACATATTCGTCTCGAAATATGTTGGAGAC
TTCGGAATTGTAGTAAACAATTTCAACTATCCATTTATAATAACTATTATAATTATTACACTATTGTCCGCAATATATTC
CTTAAGGTATATGGAACATAAGTTTGATGAGGAGAGAAAAAGTAGCTGGGGTCTTTACTATGCTTTGTATACTTTATTTG
CCCTTTCGATGCTATACACTGTACTATCGACTAATCTACTGGAATTATATATATTTTTGGAGATTTCGTTAATTTCGTCA
TTTTTACTGATAGCGCTTTATGGGTATGGTGATAGACGCAGAATAAGCCTTATGTATTTCATATGGACGCACATTGGTAC
AATATTACTCTTGGCTTCAATAATAGTAATAGGTCTTTCTACAGGCTCTATGAACATTTACGTTGATGCTTATACTTTTG
CCAATTATTCAACTATATCCTATGGAATCCTAGTATTTATAATAGCAGTAGTTGGTATGTTTGTAAAAGGTGCTCAAGCT
GGTTTCAACATATGGCTACCGTATGCCCATGGCGAAGCACCAACTCCTATTTCAGTATTGTTAAGTCCAAATATGGTTGG
TTTAGGAATATTTGTAGTAATAATTTACTATTATCTATTTCCCACTATGTCCTTCTTAGCTCCCATATTCATAGCTTGGG
CCATTATCACGATGATTTATGGTGGTATTAACGCTCTGGCTCAAAAAGACTTTAAGAGGTTTTTAGCGTATTCTAGTGTT
TCTCAAATGGGTTATATGCTATTAGGTGCTTCTATAGCATTTTTAAGCGGATTATCAAATTCCATTATTTCGTTGCCTAT
AGGAATATTGGCGAGTATTTTGATCTATGTATCTCATGGTTTTGGCAAAGCTATATTATTCATGAGCGCTGGTGCGTCAA
TTACCGAACTTAATGAAAGGAATATTGAAAAGTTAGGGGGACTATATCTTTCTTCTCCCCTTCATTCAACATTAGCGTTT
ATAGGCGCATTGAATCTTTTGGGTCTGCCTCCTACAATTGGACTGATAAGTGAAGCATTGTTGATATTTTCATTAGGTAC
TATATTAGATAAGATAGGAATAGTAGGTTTTATAGTGATAGTAGCTTTTATAATGATCGCAATAGGTACCTCTTCGGCTT
ATATAGGTTATTTGTTCAAGACTGTGTACGCAGGTAAAAAGGAAACCAAGAATATTGATAACGTAAAAGAGTATTCTATT
CCAATGTTATTAATAGGAATATTTAGCATAATTACGTTCTTTATTCCTCAATATGTATCACCTTCTTTAGTATTCACGTC
ACTGTTTTCAAATTCTACAATTTTGCCATTCATAGCGTTCTTGCCCGTTTTAGGTTCGCTAATCGCGCTAATAACTCCAA
AGTCATTAAATCAAGATTTGAGAGGCGCAATAGTAGTGGTATCAATAGGTATTTCAATGGTCTTATCTGCTGTGTTATTA
GTTAATAATTTAGGAAAACCCTTATTCGGACACCCTCAGTTATCATATTCATTTGGTTATCTACAATTTAGTGCTAATTT
GCTTCAATCCATTTTAGCCCTATTTGTATCTTCACTATCATTCTTTATAGCATTATATAGTATAGGATACATGAGAGAAG
ATAACGTTTTAAGAAGGTACTGGGGTTTCTTTGGACTTTTCGTAACATCAATGTTATCTGTTGTTTTAGCTAATAACGTT
TTATTATTTATTGCTGGATGGGAGGGAACTAGTCTAGCATCTTATGGTTTAATTAGTTACTGGCTAGATGACAATGAAAG
GAATGTAGTTGGAGATTTTGGAAGAAGAATATTCGGAATCGAAAATGTCTCCAAACCAACAACTAGTGGGATTAGAGCTT
TAATTTTCACTCGTGTAGGTGATGTTGGCTTGCTAGCGGTACTAGGATATTTGCTTTCATTATCAAGTTACAATTATATC
TTATATCCCATTTCAAATGTATCGTCCACAGTATTTTCTGCATTGTACGCTGTAGCCTCACATCCAGAAGGGTGGTTAAT
ATTGCTAATATTCTTTTTAGGTGGGCTTGCTAAAAGTGCACAATTTCCTTTCACGCAATGGCTATTGACTGCTATGACTG
GTCCCACACCAGTTAGTGCTCTAATACACGCAGCTACTATGGTTAATTTAGGGGCTATTCTTACATTCCTCACCTATCAA
TTTATACCAATAAATTCTAACACTTATTTGTTCTTTGCCATAATGGTAGGAATAACATTATTTACAGCATTATACACAAG
TATTAACGCTCTAGCCTCAAATGAACAAAAGGTAATTTTAGCTTATTCTACAGCGGATCAAATATCGTTAATGATATTCT
CATCTTCTTTAGGTGCTTTACTTGGAAATGTAAGTTTAGGAATAATAATAGGGCTTATACAAATGTTCGCACACGGACTA
TATAAGGCATCTCTCTTTATGAACGCTGGTTCCGTAATACATTACACAGAAAGTAGATATGTAGCTTCAAAACCATTATT
ATATAAGGAGATTCCTTCTGTGTTTATTTTACAACTAATTGCTGCATTAAACCTAGCCAATTTGCCGCCTTTAATAGGAT
TTTGGGCCCACAATATCATAGGTAATTTAGCTAGTAGTACTTCAACTACGATATTTTACTTGTATATAATTCTGGAATTT
CTAGGTTCAATCTATATATTAAGATATATTGCAAGAACGTTCTTATGGAAGGGAGAGACAGATAAGACTCATGAACATGG
GCACTTAAGTATCTTAATGGTTATAAGTCCTGCATTCTTGATATTAGGATCAATAATACTAGGTGTACTTTACTTTAATC
TGGCGACCTTCTTTAATATTATACAATTTTCTGAGATAGATTTCCTTAGTTTAACATTATCTATAATAGGTTGGATAATC
GCTTTTGCCATATATACTAGATATTTGAATTTAAGTTCTGTAAAGCCCCTAATAGATTTTGTTTATTATGGTTGGTATGT
GAATCCAGCTTTTGATAAATTTGGATATCTTTTCAAAGATTTTGCTGGTGCTCTATTCAAAAACTTTGAGAGAGGAGTTA
TCGATTTAGGGCTGAACGAGAGATTACCTAAATCTATAGTAAACTTTGGATCAAGAATCTATAATGTAGTCGAGGATCAT
ATTCTTGGGGATTATATCATGTTATATGCATGGGGTATAGTTTTACTTTTAATTATAGTTTTGATTCTATTCGGGGTGAT
TGGATAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 279279 - 283725 (Additional range around SSO0328 is :500nt.)

>Sulfolobus solfataricus P2 TTGCTATTTCGCTGGTAATGTTTAAAGATTTAGAGGTAAAATTTGGTAGAGGAGCATTAGGAATATTGGCTGGAGGGGCT GTAACACTCTTGTTTTTAATTATAGTTTTTATCTCTATTCCTCAAGTTTCTTCAGCAGAAGTACAACCAATTAATTTCCA AGTATTAGCTAATGATCTTATAGAGAATTATTGGTTTCCACTAATTATACTTGTTATAGCTTTATTAACTACTTTAATTG AGGCAATATCCTTAGCTAGGAGGGATTAGCCATGATGGACCTCGGGTTATTAGGTATTACGATCTCAGGTTTACTTATAG GTATAGGCATATATGGTTTATCTTCGACGTCAAATATCATTCGAGTACTGCTATCATCTGAGATTATATTAAATTCATCT ATATTATTTGTTTTTTCCTATTCTTCCATGGTGGGAATGGTGTATAAGCCTATAGTATTTTCCCTCTTTGCAATAGGTAT GGCTTTAACAGAAGTCGTAG TTGCATTTGCGGCTGTTATACTTTACTATAGGCAAAAGGATAAACTGGAGGTGGAATAA GATGTTTCCTCTCTCCTTTATAATGTTAATAATATCCTTTATACTTGCAGTTAGTATATTTTTTGTTAGATCAAGAGTAG CCTCATTTATTTTGAGTTTTGTATCAATAGCCATAAATATCCCATTTTTGGTTTTTAGAGGTATTTTTGAAAACATATTC GTCTCGAAATATGTTGGAGACTTCGGAATTGTAGTAAACAATTTCAACTATCCATTTATAATAACTATTATAATTATTAC ACTATTGTCCGCAATATATTCCTTAAGGTATATGGAACATAAGTTTGATGAGGAGAGAAAAAGTAGCTGGGGTCTTTACT ATGCTTTGTATACTTTATTTGCCCTTTCGATGCTATACACTGTACTATCGACTAATCTACTGGAATTATATATATTTTTG GAGATTTCGTTAATTTCGTCATTTTTACTGATAGCGCTTTATGGGTATGGTGATAGACGCAGAATAAGCCTTATGTATTT CATATGGACGCACATTGGTACAATATTACTCTTGGCTTCAATAATAGTAATAGGTCTTTCTACAGGCTCTATGAACATTT ACGTTGATGCTTATACTTTTGCCAATTATTCAACTATATCCTATGGAATCCTAGTATTTATAATAGCAGTAGTTGGTATG TTTGTAAAAGGTGCTCAAGCTGGTTTCAACATATGGCTACCGTATGCCCATGGCGAAGCACCAACTCCTATTTCAGTATT GTTAAGTCCAAATATGGTTGGTTTAGGAATATTTGTAGTAATAATTTACTATTATCTATTTCCCACTATGTCCTTCTTAG CTCCCATATTCATAGCTTGGGCCATTATCACGATGATTTATGGTGGTATTAACGCTCTGGCTCAAAAAGACTTTAAGAGG TTTTTAGCGTATTCTAGTGTTTCTCAAATGGGTTATATGCTATTAGGTGCTTCTATAGCATTTTTAAGCGGATTATCAAA TTCCATTATTTCGTTGCCTATAGGAATATTGGCGAGTATTTTGATCTATGTATCTCATGGTTTTGGCAAAGCTATATTAT TCATGAGCGCTGGTGCGTCAATTACCGAACTTAATGAAAGGAATATTGAAAAGTTAGGGGGACTATATCTTTCTTCTCCC CTTCATTCAACATTAGCGTTTATAGGCGCATTGAATCTTTTGGGTCTGCCTCCTACAATTGGACTGATAAGTGAAGCATT GTTGATATTTTCATTAGGTACTATATTAGATAAGATAGGAATAGTAGGTTTTATAGTGATAGTAGCTTTTATAATGATCG CAATAGGTACCTCTTCGGCTTATATAGGTTATTTGTTCAAGACTGTGTACGCAGGTAAAAAGGAAACCAAGAATATTGAT AACGTAAAAGAGTATTCTATTCCAATGTTATTAATAGGAATATTTAGCATAATTACGTTCTTTATTCCTCAATATGTATC ACCTTCTTTAGTATTCACGTCACTGTTTTCAAATTCTACAATTTTGCCATTCATAGCGTTCTTGCCCGTTTTAGGTTCGC TAATCGCGCTAATAACTCCAAAGTCATTAAATCAAGATTTGAGAGGCGCAATAGTAGTGGTATCAATAGGTATTTCAATG GTCTTATCTGCTGTGTTATTAGTTAATAATTTAGGAAAACCCTTATTCGGACACCCTCAGTTATCATATTCATTTGGTTA TCTACAATTTAGTGCTAATTTGCTTCAATCCATTTTAGCCCTATTTGTATCTTCACTATCATTCTTTATAGCATTATATA GTATAGGATACATGAGAGAAGATAACGTTTTAAGAAGGTACTGGGGTTTCTTTGGACTTTTCGTAACATCAATGTTATCT GTTGTTTTAGCTAATAACGTTTTATTATTTATTGCTGGATGGGAGGGAACTAGTCTAGCATCTTATGGTTTAATTAGTTA CTGGCTAGATGACAATGAAAGGAATGTAGTTGGAGATTTTGGAAGAAGAATATTCGGAATCGAAAATGTCTCCAAACCAA CAACTAGTGGGATTAGAGCTTTAATTTTCACTCGTGTAGGTGATGTTGGCTTGCTAGCGGTACTAGGATATTTGCTTTCA TTATCAAGTTACAATTATATCTTATATCCCATTTCAAATGTATCGTCCACAGTATTTTCTGCATTGTACGCTGTAGCCTC ACATCCAGAAGGGTGGTTAATATTGCTAATATTCTTTTTAGGTGGGCTTGCTAAAAGTGCACAATTTCCTTTCACGCAAT GGCTATTGACTGCTATGACTGGTCCCACACCAGTTAGTGCTCTAATACACGCAGCTACTATGGTTAATTTAGGGGCTATT CTTACATTCCTCACCTATCAATTTATACCAATAAATTCTAACACTTATTTGTTCTTTGCCATAATGGTAGGAATAACATT ATTTACAGCATTATACACAAGTATTAACGCTCTAGCCTCAAATGAACAAAAGGTAATTTTAGCTTATTCTACAGCGGATC AAATATCGTTAATGATATTCTCATCTTCTTTAGGTGCTTTACTTGGAAATGTAAGTTTAGGAATAATAATAGGGCTTATA CAAATGTTCGCACACGGACTATATAAGGCATCTCTCTTTATGAACGCTGGTTCCGTAATACATTACACAGAAAGTAGATA TGTAGCTTCAAAACCATTATTATATAAGGAGATTCCTTCTGTGTTTATTTTACAACTAATTGCTGCATTAAACCTAGCCA ATTTGCCGCCTTTAATAGGATTTTGGGCCCACAATATCATAGGTAATTTAGCTAGTAGTACTTCAACTACGATATTTTAC TTGTATATAATTCTGGAATTTCTAGGTTCAATCTATATATTAAGATATATTGCAAGAACGTTCTTATGGAAGGGAGAGAC AGATAAGACTCATGAACATGGGCACTTAAGTATCTTAATGGTTATAAGTCCTGCATTCTTGATATTAGGATCAATAATAC TAGGTGTACTTTACTTTAATCTGGCGACCTTCTTTAATATTATACAATTTTCTGAGATAGATTTCCTTAGTTTAACATTA TCTATAATAGGTTGGATAATCGCTTTTGCCATATATACTAGATATTTGAATTTAAGTTCTGTAAAGCCCCTAATAGATTT TGTTTATTATGGTTGGTATGTGAATCCAGCTTTTGATAAATTTGGATATCTTTTCAAAGATTTTGCTGGTGCTCTATTCA AAAACTTTGAGAGAGGAGTTATCGATTTAGGGCTGAACGAGAGATTACCTAAATCTATAGTAAACTTTGGATCAAGAATC TATAATGTAGTCGAGGATCATATTCTTGGGGATTATATCATGTTATATGCATGGGGTATAGTTTTACTTTTAATTATAGT TTTGATTCTATTCGGGGTGATTGGATAA TGGATCCTATGTATTATTTACCAATTTTAATACCATCAATTTTTATTTTGT TTTCATCTATATCAGTTTTATTTATAGACAATGGTCTTGATGAAAATAGGTTTAGATTATCAGTAATACTTTCTGTAGTA TTATTAGGAGTTAGCCTAGCGTTTTTAATATACTCGTGGACAGCTAGTGTTATAAACTATACTCTATTCTCTAAATCTCT ACTTATAGACGTGCCGGGCTATTTCTTTTCAATAACTGTATTTAGTATAGGTATACTTGCTATTTTATTGAGTAAAGATC ATATAATATCTTGGCCTACACGCTCTTCGATGCTGTCATTGATGTTGCTATCTTTACTAGGTCTATTTTATATGTCTTTT GCGAACAATATTATCATTGTTCTCACAACTTGGGCAATATCATCAGCTGCAAGTTATGCAATAGCTATGCTTAGAAAGGA TTACAAGTCAGTTGATGCTGGTATTAAATATCTTATTATGGGGCTTTT