SSO0405

Coordinates:355009-355788

>SSO0405 Proliferating cell nuclear antigen homolog (PCNA) (pcnA-1)
MIYLKSFERNIRLINMKVVYDDVRVLKDIIQALARLVDEAVLKFKQDSVELVALDRAHISLISVNLPREMFKEYDVNDEF
KFGFNTQYLMKILKVAKRKEAIEIASESPDSVIINIIGSTNREFNVRNLEVSEQEIPEINLQFDISATISSDGFKSAISE
VSTVTDNVVVEGHEDRILIKAEGESEVEVEFSKDTGGLQDLEFSKESKNSYSAEYLDDVLSLTKLSDYVKISFGNQKPLQ
LFFNMEGGGKVTYLLAPKV

>SSO0405 Proliferating cell nuclear antigen homolog (PCNA) (pcnA-1)
ATGATATATCTTAAATCTTTTGAAAGGAATATAAGATTGATTAACATGAAAGTAGTTTACGATGATGTAAGGGTTCTTAA
AGATATCATACAAGCCTTAGCCAGGTTAGTTGATGAAGCGGTATTAAAGTTTAAGCAAGACAGCGTAGAGTTAGTCGCGC
TAGATAGAGCTCATATTTCCCTTATATCAGTAAACTTGCCTAGAGAGATGTTTAAGGAGTATGATGTAAATGACGAATTT
AAATTTGGCTTTAATACTCAATATTTAATGAAAATTTTGAAAGTAGCCAAGAGAAAAGAGGCAATAGAGATAGCTAGTGA
ATCTCCAGACAGTGTTATCATAAATATTATAGGGAGTACTAATAGAGAATTTAATGTTAGGAACCTAGAGGTATCTGAAC
AAGAGATACCAGAGATCAATCTACAATTTGATATATCAGCGACTATTTCCTCAGATGGTTTTAAGTCTGCTATATCAGAA
GTTTCCACAGTTACGGATAATGTAGTTGTAGAGGGCCACGAAGATAGAATACTAATTAAGGCTGAAGGTGAAAGCGAGGT
TGAAGTTGAATTTTCAAAAGATACCGGAGGTCTTCAAGATTTGGAATTCTCTAAAGAGTCCAAGAATTCATATTCCGCGG
AATATCTTGATGACGTCTTATCTTTAACTAAACTTTCAGATTATGTGAAGATTTCATTCGGTAATCAGAAGCCCCTTCAG
TTATTCTTTAATATGGAGGGAGGGGGGAAAGTTACTTATTTATTAGCTCCAAAAGTTTGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 354509 - 356288 (Additional range around SSO0405 is :500nt.)

>Sulfolobus solfataricus P2 TAAAGATTACACCCCTTATACTTACGTCGCTTCTATAATATTTTAGCCCCTTTACAATTGCACCTACAGTGCTCCCTATG TTGGAGCAGTTAATTATTAAAATTATTGGGGTCTTAGTAACCTTGGCTAGCTCATAAGTGCTGTAAAGCGTGTCAACACC ATCATATAAGCCCATTACTCCCTCAATTATTCCTATATCGAATTCCTTTCCGTATTTCGCTAGACTTCTTTTTACATTAT TTTTTCCCATCATCCATAAGTCCAAGTTTATTGAAGGAAAACCTGTGGCAATCTTGTGATATCCTGGATCTATGAAATCT GGTCCCGCTTTGAAACCTCTGACTTTATATTTTTTAGATAGTGCTCTCATTATTGCTGAGGTTATAAGCGTTTTACCTGA TCCACTTCTATCTGATGATAACAATATCCTTTTCATTGCTATTAGAAGTATATATTTAAAAGGTAGTTAAATCTTGTGAA TCTTTAGTTAAATTGAAAGT ATGATATATCTTAAATCTTTTGAAAGGAATATAAGATTGATTAACATGAAAGTAGTTTA CGATGATGTAAGGGTTCTTAAAGATATCATACAAGCCTTAGCCAGGTTAGTTGATGAAGCGGTATTAAAGTTTAAGCAAG ACAGCGTAGAGTTAGTCGCGCTAGATAGAGCTCATATTTCCCTTATATCAGTAAACTTGCCTAGAGAGATGTTTAAGGAG TATGATGTAAATGACGAATTTAAATTTGGCTTTAATACTCAATATTTAATGAAAATTTTGAAAGTAGCCAAGAGAAAAGA GGCAATAGAGATAGCTAGTGAATCTCCAGACAGTGTTATCATAAATATTATAGGGAGTACTAATAGAGAATTTAATGTTA GGAACCTAGAGGTATCTGAACAAGAGATACCAGAGATCAATCTACAATTTGATATATCAGCGACTATTTCCTCAGATGGT TTTAAGTCTGCTATATCAGAAGTTTCCACAGTTACGGATAATGTAGTTGTAGAGGGCCACGAAGATAGAATACTAATTAA GGCTGAAGGTGAAAGCGAGGTTGAAGTTGAATTTTCAAAAGATACCGGAGGTCTTCAAGATTTGGAATTCTCTAAAGAGT CCAAGAATTCATATTCCGCGGAATATCTTGATGACGTCTTATCTTTAACTAAACTTTCAGATTATGTGAAGATTTCATTC GGTAATCAGAAGCCCCTTCAGTTATTCTTTAATATGGAGGGAGGGGGGAAAGTTACTTATTTATTAGCTCCAAAAGTTTG A TAATGAATGTGAAAAAAGCCTTAGTGGGTAGTTTTCCAAAAAATCCAAAATTAGGGAAAGTAATTTCATGGTACAATA CAGGCAAGATAAATAAGGAGAAACTAGAGAAGCATATAAGTGAGAATATAAAAAAATTGTTTGAGCTAGCTGGAAATATC AAACTAGAGTATACTACCAATGGACTTTTTAGGTGGGATGACATAGTGGATGTAACATTTGGTTTTATTAGTGGTACTGA AAAGGGTCCCCTACAAAGGTTTTTCGATAATAACTTCTATTATAGACAACCTATAATTAAGGAGAAAATAAATGTAAAGA AGAGAGAGGAAAACTCTTTCCTACAAGATTTGGAATTCTCTAGGAAAATTAAGGAAGAAGTAAGTTTACCTTCAAAGTTA AAGGCCGTAATTCCAGGACCTTTAACGTACTATGTACTATCTGATAATCGGTATTACAATAGTCCAATAGAACTAATGAT GGATTATGCATCAGTGGTTAA