SSO0427

Coordinates:371931-372701

>SSO0427 Protein L-isoaspartate methyltransferase
MMPLNEGDPVVIWIDPKRVYISKLERGKRLDTDKGVVFYDNLIGLEYGTSLTLKTGVKAYLLKPTIQDLYSKGLKRPSQV
LYPKDIGYILTTLSLNQVKTVIEAGTGSGFLTISLALSLSENAKIYTYDIREDMQKVAKFNANVLGVQDRIVFKLKDIRE
GIDEKEVDAIFLDMPDPWNAIPKLYESLKPSSTIIIFVPTVNQIEKTYFAMKNSGIIDIHVEELILREYQVKENAIRPRN
IGIMHTGFIIRGRKSI

>SSO0427 Protein L-isoaspartate methyltransferase
ATGATGCCATTAAACGAAGGAGATCCGGTAGTAATTTGGATAGATCCAAAAAGAGTATATATTTCCAAACTGGAAAGAGG
CAAAAGGCTTGATACTGATAAGGGAGTAGTATTTTACGACAATTTAATAGGTCTTGAATATGGTACCTCACTAACCTTGA
AAACTGGTGTTAAAGCCTACTTACTAAAACCTACTATCCAAGATCTCTACTCCAAAGGGTTAAAGAGACCCTCACAAGTT
CTATATCCTAAAGATATAGGATACATTTTAACTACCCTTTCACTAAATCAAGTAAAGACAGTTATCGAAGCTGGAACTGG
TTCTGGATTTCTTACAATCTCCTTAGCTTTAAGTTTAAGTGAGAACGCTAAGATCTATACTTATGATATAAGAGAAGATA
TGCAAAAAGTAGCTAAATTTAACGCAAATGTGTTGGGTGTTCAAGATAGGATAGTATTCAAATTGAAGGATATAAGGGAA
GGTATAGACGAGAAGGAGGTAGACGCAATTTTTCTAGATATGCCCGATCCATGGAACGCCATACCAAAGCTTTATGAGTC
TCTGAAACCTTCGTCCACCATAATTATATTTGTTCCTACAGTAAATCAAATAGAGAAAACATACTTCGCAATGAAGAATT
CTGGAATTATAGATATTCATGTAGAGGAACTTATCTTGAGGGAGTATCAAGTTAAAGAGAACGCTATAAGGCCTAGAAAT
ATAGGTATCATGCATACGGGTTTTATTATTAGGGGAAGAAAATCAATATAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 371431 - 373201 (Additional range around SSO0427 is :500nt.)

>Sulfolobus solfataricus P2 AAAAGCGTTAATTTACCAGATATCTCATCAGCTCAAGTTAAGAGAGCTCAATCGCTATTTGGCAGTGGTATAATCACATC TGACTCAATTCTCCTAGTCATAAAGAATAATGATATATTAACTGGTCTATTTTCAAATCATAAATATCTAATAGACATCG GCACAGTATATTTTAATCACTTATGGTCTACATTACCGGGATAACTCTTATAAATGTTATAAAATTAACTATGCTATTTG AGTTTCTATGAAAATAATAACGGTAAAACTACCAGAGCAGTTTCTGGAAGCAATAGACGAATTAGTTAATACGGGTAGAT ATGGTTCTAGAAGTGAAGTCATAAGAGCAGCAATAGGGGATTTTATACGGAAAGAACTATGGATAACTACAGAAGAGTAG ATGATGAAGGCTGGTATTTTTGATAAAGTGAAATAAGACACCAAAGCTGAACCTTTTTTGTCAAGTAGAAAGATACTTAA CTAACTATTTTTCCTATTAT ATGATGCCATTAAACGAAGGAGATCCGGTAGTAATTTGGATAGATCCAAAAAGAGTATA TATTTCCAAACTGGAAAGAGGCAAAAGGCTTGATACTGATAAGGGAGTAGTATTTTACGACAATTTAATAGGTCTTGAAT ATGGTACCTCACTAACCTTGAAAACTGGTGTTAAAGCCTACTTACTAAAACCTACTATCCAAGATCTCTACTCCAAAGGG TTAAAGAGACCCTCACAAGTTCTATATCCTAAAGATATAGGATACATTTTAACTACCCTTTCACTAAATCAAGTAAAGAC AGTTATCGAAGCTGGAACTGGTTCTGGATTTCTTACAATCTCCTTAGCTTTAAGTTTAAGTGAGAACGCTAAGATCTATA CTTATGATATAAGAGAAGATATGCAAAAAGTAGCTAAATTTAACGCAAATGTGTTGGGTGTTCAAGATAGGATAGTATTC AAATTGAAGGATATAAGGGAAGGTATAGACGAGAAGGAGGTAGACGCAATTTTTCTAGATATGCCCGATCCATGGAACGC CATACCAAAGCTTTATGAGTCTCTGAAACCTTCGTCCACCATAATTATATTTGTTCCTACAGTAAATCAAATAGAGAAAA CATACTTCGCAATGAAGAATTCTGGAATTATAGATATTCATGTAGAGGAACTTATCTTGAGGGAGTATCAAGTTAAAGAG AACGCTATAAGGCCTAGAAATATAGGTATCATGCATACGGGTTTTATTATTAGGGGAAGAAAATCAATATAA GGTACTG TTATTGGAGTATATTTGATGAGTGAAGTTAAGTTTAACGCATATTCTAAAGCGATAATGGAGTTTGAGGATGAAATAAAG AGAATAAAGAAAGAGATAGCAGATGATAGTAAAAGATTAATCACCCTTTCGGATTCTTATCTTTCTGAGTTAAGGGCAAC TGCTGAGAAATCATTAGGAGATGTTCAGAAATTATTGAACGATGAGAAAAAAAGGCAGTTAGATGAGATAAGAAATAAAT ATATTTCAGAACGAGAAAAACAATTAGAGGAGATAAGAAAAGAGGCTGAGAAGAATATCGATAAGGTTGTAAATGAGGTT ATAAGGCAACTATTAGGTGTCTTTAAATGAGTTATGCGATCTATTCTTTTATACATTCAATTTCCAGAACGCAAAAGGTT TCATTATTAACAAAAGGTTTAGTTAATGAATTAATAAGTAGTGAAAGTTGGAATAATGTTGCCTCTCTGCTTAAAGAAAG GGGAATAATTGA