SSO0501

Coordinates:433155-433844

>SSO0501 hypothetical protein SSO0501
MQILVELHPKKKPEKLLNEIKILSSFDGFDIPDSPMGMPSPIPTFVASLIRYSLSLDRKTIIINQRLLDVNELFIRSLSI
TAKMLDAQIAFTKGDKPKYGKEVGYLSSDEAVNLAKEYGVKSGMMISLRKNENEIMARLDSNADFFLVLRMKDVDQIKYY
GPKLIERAIPYLIVMTDKNRELVKSLDQPSFVENEIFSIINSLDSIGVKTVLISSLGDLSFFERLHARL

>SSO0501 hypothetical protein SSO0501
ATGCAAATATTAGTAGAACTACATCCCAAGAAAAAACCGGAAAAATTACTAAATGAAATAAAAATTTTATCGTCGTTTGA
TGGATTTGATATACCGGACTCACCCATGGGTATGCCATCACCTATACCGACTTTTGTGGCTTCTTTAATTAGATATTCTC
TATCTCTAGACAGAAAAACAATAATCATAAACCAAAGGCTATTAGATGTCAATGAATTATTTATCCGTTCATTATCAATA
ACCGCTAAGATGTTAGATGCCCAAATAGCTTTCACAAAGGGGGATAAACCGAAATACGGAAAAGAAGTGGGTTATTTGTC
ATCAGACGAGGCTGTGAATTTGGCAAAAGAATATGGTGTAAAAAGCGGAATGATGATAAGTTTAAGAAAAAATGAGAATG
AAATTATGGCCAGATTGGATTCAAATGCCGATTTCTTCCTAGTTCTTAGAATGAAAGATGTAGATCAGATTAAGTATTAT
GGTCCAAAGCTTATTGAAAGAGCAATACCTTACTTAATAGTAATGACTGATAAGAATAGAGAATTAGTAAAAAGCCTCGA
TCAACCTTCTTTTGTAGAGAATGAGATATTTTCAATTATCAATTCGCTTGATAGTATAGGAGTAAAGACAGTCTTAATTT
CATCTCTAGGTGATTTAAGCTTCTTCGAAAGGTTACACGCAAGACTATAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 432655 - 434344 (Additional range around SSO0501 is :500nt.)

>Sulfolobus solfataricus P2 ATCTCATTGTACATTTCCTTATCCCTCTCCTCTATTCTCTTTAACGACCAAGGAAGCAATCCTTTCTTCTTAACTCCGTT TATTACAGATTTTAACCAAGACTCGTAAACTTTCCCAGATTGTAGTTTGTAATAGAACTCTTTTAATGTTTGTAAGGCTT CATCTTCATTAACGCCTTTTACATTTACTAAATATCTTGATGCAACGTAAAGTATAAATCTCTTCCTTGAATCTTGTAAT CCCATCTCTAAAACTTTTTCTATCCATGAATAATCTGACGATTTTTTGGGCTGTGGCGGAAATTTTCCTTCCACTTTAAA CAAAAAATTTCCCTCATTATCATAAATTGAGGAAGAACCCTCAGCATACTCTATATATCCAGCTGGTGTATCATCAGGAT AATGAAGAATAATTTTTTTGGCTTTTTTCTCTTGACTCACAATAGATGATTAGTCTTCAAGGAAAAAAATATAGCTTAAA ATTTGTACTACTTCTCTAA ATGCAAATATTAGTAGAACTACATCCCAAGAAAAAACCGGAAAAATTACTAAATGAAATA AAAATTTTATCGTCGTTTGATGGATTTGATATACCGGACTCACCCATGGGTATGCCATCACCTATACCGACTTTTGTGGC TTCTTTAATTAGATATTCTCTATCTCTAGACAGAAAAACAATAATCATAAACCAAAGGCTATTAGATGTCAATGAATTAT TTATCCGTTCATTATCAATAACCGCTAAGATGTTAGATGCCCAAATAGCTTTCACAAAGGGGGATAAACCGAAATACGGA AAAGAAGTGGGTTATTTGTCATCAGACGAGGCTGTGAATTTGGCAAAAGAATATGGTGTAAAAAGCGGAATGATGATAAG TTTAAGAAAAAATGAGAATGAAATTATGGCCAGATTGGATTCAAATGCCGATTTCTTCCTAGTTCTTAGAATGAAAGATG TAGATCAGATTAAGTATTATGGTCCAAAGCTTATTGAAAGAGCAATACCTTACTTAATAGTAATGACTGATAAGAATAGA GAATTAGTAAAAAGCCTCGATCAACCTTCTTTTGTAGAGAATGAGATATTTTCAATTATCAATTCGCTTGATAGTATAGG AGTAAAGACAGTCTTAATTTCATCTCTAGGTGATTTAAGCTTCTTCGAAAGGTTACACGCAAGACTATAA AAGATAATG AGAAAACTAAATTGATTGAGCGCGAATTTGTCCTTCAATATTAAGAATCTCCTGAGCGTGCTCTGGCATTTTGTTTATTA AATCATTCAGCTCAAGATACCAATAATTTTCCTTTTCACTATCCACTAGTTGTATGTAAACTTTCCTCCTAGTTAGTATA ACTTTTTTAATACATAAGGAACTTTTACTACATTCAACAGAAACTTCTCTCTTATAGAGTATTGTTAAAAGTTGCTCTAG ACTATGCTTAATCTCTTCACCAATATTTATCTTTTTACCCTCAACTAAAATTTCTTTTATTCCCTTCTTTTGTTTATGGC AAATCTCTTGCATATTGCATTTTTCGCTTATAATCTTTACATATTCATATAACTCATTCTCAATTGATGAAATATGATAA ATAAATAAGTTAGTGTCCATTTCATTTCCATCAAAATTTATCCTATTTTCGTTTACCTTGATATAAAACGATTTTTTCGC GTTTCCGCATT