SSO0631

Coordinates:544884-545540

>SSO0631 219 aa !not a gene!
MFFIGHKNLGGFNNTFVGRETRSLPIYLNLITGSLVISPITLQGYSYSSKASQTSLTFFSSTAYNILSCVSDMITSDGFI
FFTRNGIFSISTVAPSPFVISVTATASPPPPKSLIASTLSAISKVTSNIIFPAKGSAICTAPISSSPLNFLDANEAPPKP
STPVSPANTNLSPALSTILGFILSFLTIPIAATSTSGLSLYVSSNDNSPPTTGTPILLP

>SSO0631 219 aa !not a gene!
GTGTTTTTTATTGGCCATAAAAACCTCGGCGGGTTTAATAATACGTTTGTGGGTAGGGAGACGAGATCTTTACCAATATA
TCTAAACTTAATTACTGGTTCATTAGTTATCTCACCTATTACACTGCAAGGGTATTCGTATTCTTCAAAAGCTTCGCAAA
CTTCCTTAACGTTTTTCTCCTCCACTGCATATAACATTCTCTCTTGTGTTTCAGATATGATTACATCTGACGGATTCATA
TTTTTTACACGTAATGGAATTTTCTCTATATCTACTGTAGCACCAAGTCCGTTTGTTATCTCAGTTACAGCAACTGCTAG
CCCTCCACCACCTAAGTCTTTAATAGCCTCTACTTTATCAGCGATTTCTAAGGTTACATCCAATATAATTTTCCCAGCAA
AAGGATCAGCTATCTGTACTGCTCCAATTTCGTCTTCACCACTTAACTTTCTAGACGCAAATGAAGCTCCGCCTAAACCA
TCAACTCCGGTTAGTCCAGCTAACACTAATTTAAGTCCCGCTTTATCTACAATACTTGGTTTTATCTTGTCTTTTCTAAC
TATTCCGATCGCTGCTACATCTACTAGCGGATTATCATTATATGTATCATCGAATGATAATTCTCCACCAACTACCGGGA
CTCCAATACTATTGCCA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 544384 - 546040 (Additional range around SSO0631 is :500nt.)

>Sulfolobus solfataricus P2 TGCCATAACTATTAAAGGTGTTGGCTTTATTGGTCTTCCTTGATTATTTTCATTATAAAATGAAACTTTCCCACCAACAA TAGGTATGTTAAAGAATCTAGTAGCCTCTCCTATACCTCTTATTGCTTCTACGAAAGTATAGTAAACTTCTGCCTTCTTT GGATCCCCAAACTGTAAATGATCAACTGCTACCATTCCTCTAGCCCCTACTGTAGCTAAATTCCTATAGGCCTCTGCTAC TATTCCTTTTCCGCACTCATATCCATCCTCAGCGCACATGTCAGGATTTGCATCCGCTTTTATCGCCAATAACTTACCAT TAGGAAGCGAGACTACTGCACTATCAGCATCACCGGGTTTAACTACTGTTGAGGTATTTACTTCATAATCAAACTGTGAA TAGGCCCATCCTTTACTTACTAAATCTGGATGTGTTAATACAGTATAAATTGCACTTTCTAACGGTAAATCAACAATTTT CTCTTCAACATTTTTCTTA GTGTTTTTTATTGGCCATAAAAACCTCGGCGGGTTTAATAATACGTTTGTGGGTAGGGAG ACGAGATCTTTACCAATATATCTAAACTTAATTACTGGTTCATTAGTTATCTCACCTATTACACTGCAAGGGTATTCGTA TTCTTCAAAAGCTTCGCAAACTTCCTTAACGTTTTTCTCCTCCACTGCATATAACATTCTCTCTTGTGTTTCAGATATGA TTACATCTGACGGATTCATATTTTTTACACGTAATGGAATTTTCTCTATATCTACTGTAGCACCAAGTCCGTTTGTTATC TCAGTTACAGCAACTGCTAGCCCTCCACCACCTAAGTCTTTAATAGCCTCTACTTTATCAGCGATTTCTAAGGTTACATC CAATATAATTTTCCCAGCAAAAGGATCAGCTATCTGTACTGCTCCAATTTCGTCTTCACCACTTAACTTTCTAGACGCAA ATGAAGCTCCGCCTAAACCATCAACTCCGGTTAGTCCAGCTAACACTAATTTAAGTCCCGCTTTATCTACAATACTTGGT TTTATCTTGTCTTTTCTAACTATTCCGATCGCTGCTACATCTACTAGCGGATTATCATTATATGTATCATCGAATGATAA TTCTCCACCAACTACCGGGACTCCAATACTATTGCCA TAAGCCGCAATCCCTGCAATTATGTTCTTAAGCAACCATACG TTTTTCTTTATTTTCAGATTTCCAACCCTTATCATGTCCATAAGTGCAATTGGCTTTGCCCCCTTGCTAATAATGTCCCT TATTATTCCTCCTACACCAGTTGCAGCACCATTGAATGGATCAATGGCAGAAGGATGGTTATGGCTTTCAACCTTTATTA CTACTGCCCATCCATCTCCTATATCTACCGCTCCAGCATCTTGCCAGTCTTTTATGCCCATTATAACATTAGGACTATCT ATGGAAAAGCTCTTTAAGAAGATTTTAGATGATTTATAAGAGCAATGCTCTGACCATACTGCATCAATAACTCTCCATTC GGTCTCATTAGGTTCTCTACCTAGTCTTTTTCGAATCTCGTCCATCTCTATAGGGAGAAGATTTATGCCCATTCTCCTAA CCTCCTCAAAAGAATTAACCCGTCAACAGTTCCGTCAATTGAAGTCAGTTTAAAGGAA