SSO0665

Coordinates:574064-574576

>SSO0665 NADH dehydrogenase subunit B (NuoB)
MTEQTILMGNLNEVAKKAAQWLINRKPIKSIIDWGISFSLWPPHFTTSCCGTEFGAFAAARFDAERYGMLPFSSARQSNI
LILEGTLSRKMGRAARIVYDQMPEPKYVIALGACILEGGIFWNSYNTVLPSDIGIPVDLYVPGCPIRPEAVARAVLMLQK
KIRTQGALKT

>SSO0665 NADH dehydrogenase subunit B (NuoB)
ATGACAGAACAGACTATTTTAATGGGTAATTTAAATGAAGTAGCTAAAAAGGCGGCTCAATGGCTAATTAATAGGAAACC
CATCAAATCGATAATTGATTGGGGAATTTCATTTTCTTTATGGCCACCTCACTTTACTACATCTTGTTGTGGTACGGAAT
TTGGAGCTTTCGCAGCTGCAAGATTTGATGCAGAGAGATATGGGATGTTGCCATTCTCCTCTGCTAGACAATCAAATATA
CTTATACTGGAAGGTACGCTAAGTAGAAAAATGGGTAGAGCAGCGAGAATTGTTTATGACCAGATGCCAGAACCAAAATA
CGTTATCGCCCTTGGAGCGTGTATACTCGAAGGAGGAATCTTTTGGAATTCTTATAATACCGTGCTTCCCTCAGATATTG
GAATACCAGTTGATTTATACGTTCCGGGATGCCCAATAAGGCCAGAGGCTGTAGCTAGAGCAGTATTAATGTTACAGAAG
AAGATAAGAACTCAAGGAGCCCTTAAGACATAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 573564 - 575076 (Additional range around SSO0665 is :500nt.)

>Sulfolobus solfataricus P2 TGGCATTCTTACTGCTACAGTTTCTAGCCCTCCGGTGGTCTCTTTAGGAACTTTCTCTGTTTTCTTTAAGACAAATGTTA ATGGTCCGGGCCACACTATATTCACTAAATTGATTATTTTTTTGGGTATATCTTTAGCTACTTCATAAAGCTGATCTATA TTTGATATATGAACTATAAGAGGATTGTCCATTGGTCTATTTTTAGCGATGAATATCTTTTTCACCGCTTCTGGATCTAG AGCGTTTGCGCCTAATCCATAAACAGTTTCTGTAGGAAAGACTACAGTACCGCCGGCTTTTATTACATTAGCAGCCTTTT TTATCTTATCTAATTCTGGATATAATGGATCGACCTTAAGTACTTCAGTCATTATTTTTAACTTTAAAGATTAACAAGAA AATATACTTGTCGATGATGAGTCAAGAAAAATGATTTGATGATTTTTGAGGTGATCTCTGAATAAAGTTATTTAAAGGAG TAGGAAAAGAGTGTATAGGA ATGACAGAACAGACTATTTTAATGGGTAATTTAAATGAAGTAGCTAAAAAGGCGGCTCA ATGGCTAATTAATAGGAAACCCATCAAATCGATAATTGATTGGGGAATTTCATTTTCTTTATGGCCACCTCACTTTACTA CATCTTGTTGTGGTACGGAATTTGGAGCTTTCGCAGCTGCAAGATTTGATGCAGAGAGATATGGGATGTTGCCATTCTCC TCTGCTAGACAATCAAATATACTTATACTGGAAGGTACGCTAAGTAGAAAAATGGGTAGAGCAGCGAGAATTGTTTATGA CCAGATGCCAGAACCAAAATACGTTATCGCCCTTGGAGCGTGTATACTCGAAGGAGGAATCTTTTGGAATTCTTATAATA CCGTGCTTCCCTCAGATATTGGAATACCAGTTGATTTATACGTTCCGGGATGCCCAATAAGGCCAGAGGCTGTAGCTAGA GCAGTATTAATGTTACAGAAGAAGATAAGAACTCAAGGAGCCCTTAAGACATAA ATGTTATTTACATTAGTGTGAGTAT ATCCTGTTTTTATAACAGCTTTATGGCTTTCTAGCAATCCATAGCTATTATGAGTCTCCAATGCATTATTTATCTCATCC TCTCTTATTTCCATGTCAGAACTGACCTTACAACCAGCATATTCTGAGTTACCGTCGATCCCATCAGTAGCGAAACCTAA AAGTTCAAATCTATTTCTTTTTTTAGCATATTTAAGGAAAGATAAACATACCTCTCCATTCCTTCCACCTTTCCCTGCCT TTCCTTGAATTGTAACTTCAGGCTCTCCACCAACCAATAAATAGTAAGGTCTCCTAAAAGGTATATTGTAGCTCTCTGAT GAATTATAAATCGAGGCGATAATAGCTCCAACATCTCTCGCCTCTCCTCTGATTTCAGAAGTAAGAATGAAAGAGTTCAC CAGAGTATTCGCAAGCTTCCTAAGCACCTCCATGTTATCTAAAATTATGTAATTTTTTACGATTCTAGAGAAAC