SSO0768

Coordinates:653092-654084

>SSO0768 replication factor C small subunit
MSTKVEEILWAEKYRPKTLDDIVNQREIIDRLKKFVKEKNMPHLLFAGPPGTGKTTAALALVHDLYGDNYTEYFLELNAS
DERGIDVIRNKVKEFARTVIPGDIPFKVVLLDEADNMTADAQQALRRTMELYTENTRFILACNYLSKIIEPIQSRTALFR
FYPLKKEDVVNRLIYIAKNEKAEYDQKALETIYDITMGDMRKSINILQAASAYGKISVEAVFKVLGLAQPKEVREMINLA
LQGKFTQARDKLRTLLITYGLSGEDIVKQIHREITSSEIQISEELRVLLLDYIGETEFRIIEGADDEIQLSALLAKMAIY
GNKYIGSENR

>SSO0768 replication factor C small subunit
ATGAGCACGAAGGTCGAAGAAATACTTTGGGCTGAAAAATATAGACCTAAGACGTTAGATGATATAGTAAATCAAAGAGA
GATCATAGATAGGTTAAAAAAATTTGTCAAGGAAAAGAATATGCCTCATCTACTTTTTGCTGGGCCACCGGGTACCGGAA
AAACTACCGCTGCTTTAGCTCTTGTACATGACTTATATGGAGATAATTATACAGAATATTTCCTCGAGCTAAATGCAAGC
GATGAAAGAGGAATAGATGTAATTAGAAATAAAGTAAAGGAATTCGCTCGTACGGTAATTCCAGGTGATATTCCATTTAA
GGTGGTTCTTTTAGATGAAGCAGACAACATGACCGCTGATGCCCAACAAGCTTTAAGGAGAACTATGGAGCTGTATACAG
AAAACACTAGATTTATTCTAGCTTGCAATTATTTAAGTAAAATCATTGAGCCAATACAATCTAGAACTGCATTATTTAGA
TTTTACCCGCTGAAAAAGGAAGATGTCGTTAATAGATTAATCTATATAGCTAAAAATGAGAAAGCTGAATACGATCAGAA
AGCTTTGGAAACGATCTACGATATAACTATGGGAGATATGAGAAAAAGTATAAACATTTTACAAGCCGCCTCAGCTTATG
GCAAGATTAGTGTAGAGGCCGTATTTAAGGTTTTAGGATTAGCACAGCCTAAGGAAGTTAGAGAGATGATTAACTTAGCT
CTGCAAGGTAAGTTCACACAAGCAAGAGATAAACTCAGAACTTTACTTATTACATATGGCCTATCTGGAGAGGATATAGT
AAAGCAAATACACAGAGAGATAACTTCCTCAGAGATTCAAATAAGTGAAGAGTTGAGAGTTTTACTACTAGATTATATAG
GAGAGACAGAGTTTAGAATAATAGAAGGTGCTGACGATGAAATTCAGTTATCTGCATTATTAGCTAAAATGGCAATTTAT
GGAAATAAGTATATAGGCAGTGAGAATAGATGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 652592 - 654584 (Additional range around SSO0768 is :500nt.)

>Sulfolobus solfataricus P2 TAATTTTGAATAGTGAAAGTATATATTCGATGAGAGTAGTATCTTCAGCCTTTAAGAATGAGGATTTTATACCTATTAAA TATACTTGTGATGGACAAGATCTGTCTCCGGAGTTAGAGTGGGATCTTGTTACTAACGCTAAAAGTTATGCGATAATCGT AGAAGATCCAGATGCGCCTGGAGGAACTTTCATACATTGGGTAATATACAACATAACTACCAATAGATTGCCAGAAGGAG TGCCAAGACTGTACAAATCACAATATGGTGTACAAGGTGTAAACGATTTTGGGAATATAGGGTATAACGGTCCGTGTCCT CCTAAGACACATCCACCTCATAGATATTATTTTTATGTTTATGCAATTGATACAATACTACTTGAAATTAAAAATATTAA TGCTGATAAGTTAAAATCACTAATGGAGGGACATGGGATAGAGAGAGGATTCGTAATGGGTAAATATAAGAGAAAATAAT TTCACTTATGTGGTGAGATA ATGAGCACGAAGGTCGAAGAAATACTTTGGGCTGAAAAATATAGACCTAAGACGTTAGA TGATATAGTAAATCAAAGAGAGATCATAGATAGGTTAAAAAAATTTGTCAAGGAAAAGAATATGCCTCATCTACTTTTTG CTGGGCCACCGGGTACCGGAAAAACTACCGCTGCTTTAGCTCTTGTACATGACTTATATGGAGATAATTATACAGAATAT TTCCTCGAGCTAAATGCAAGCGATGAAAGAGGAATAGATGTAATTAGAAATAAAGTAAAGGAATTCGCTCGTACGGTAAT TCCAGGTGATATTCCATTTAAGGTGGTTCTTTTAGATGAAGCAGACAACATGACCGCTGATGCCCAACAAGCTTTAAGGA GAACTATGGAGCTGTATACAGAAAACACTAGATTTATTCTAGCTTGCAATTATTTAAGTAAAATCATTGAGCCAATACAA TCTAGAACTGCATTATTTAGATTTTACCCGCTGAAAAAGGAAGATGTCGTTAATAGATTAATCTATATAGCTAAAAATGA GAAAGCTGAATACGATCAGAAAGCTTTGGAAACGATCTACGATATAACTATGGGAGATATGAGAAAAAGTATAAACATTT TACAAGCCGCCTCAGCTTATGGCAAGATTAGTGTAGAGGCCGTATTTAAGGTTTTAGGATTAGCACAGCCTAAGGAAGTT AGAGAGATGATTAACTTAGCTCTGCAAGGTAAGTTCACACAAGCAAGAGATAAACTCAGAACTTTACTTATTACATATGG CCTATCTGGAGAGGATATAGTAAAGCAAATACACAGAGAGATAACTTCCTCAGAGATTCAAATAAGTGAAGAGTTGAGAG TTTTACTACTAGATTATATAGGAGAGACAGAGTTTAGAATAATAGAAGGTGCTGACGATGAAATTCAGTTATCTGCATTA TTAGCTAAAATGGCAATTTATGGAAATAAGTATATAGGCAGTGAGAATAGATGA TACAATGGTTTTTAAAATATAGGCC GCGTTCTCTAAAAGATGTGGAGAATCAAGATGATGCGAAAAAGCAACTACAGGAGTGGATAGAGTCTTGGCTTAACGGAA ATTCTAACGTTAAGGCTGTACTATTACACGGTCCTCCAGGTGTTGGAAAAACTGTCTTAGCTGAGGCATTAGCTCACGAT TATAATTTTGAGTTATTAGAAATGAACGCTAGCGATTCAAGAAAATTGCAAGATATAAAGAGCATAGCGGAAAAGGCAGC AGTTTATGGCAGTATATTTGGAACAAAGGGTAAATTAATACTTCTAGATGAGGTTGACGGAATAAATGTTCGTGAAGATA CTGGAGCTATTCAAGGTATTTTAGAACTTATTGAAAAGACAAAATATCCTATTATAATGACAGCTAATGATCCATGGAAT CCTGGATTAAGAGAATTAAGAAATAAGGCAAAAATGATCGAATTAAGTAAGTTAGGTAAGTATCCTTTAAGAAG