SSO0863

Coordinates:738414-739154

>SSO0863 hypothetical protein SSO0863
MMCERCNKRNAINVVGGRRLCEICSKDEITKRIKRELYPRKIIVYKDKILFAYPSYLSFIREILKNIINKIYAKFNLQYY
EITLEPQHSILDDMWNLIVKSKRFSEENGISKIFLPFTADFLMAYLIYSITNQDYTYIKMIGLEYNVNNISFLIPFYNTS
LYELQGFFTNESNNIFETKDEIFNEILAWERDTLKENYELFHAFHNSKKLFETKEKEYRCEGCGGVINSPVKYCARCSLI
YSSPPY

>SSO0863 hypothetical protein SSO0863
ATGATGTGCGAAAGATGTAACAAAAGAAATGCCATAAACGTAGTAGGAGGAAGAAGATTATGTGAAATATGCAGTAAAGA
TGAGATAACCAAGAGAATTAAAAGAGAGCTTTATCCGAGAAAGATAATAGTATATAAAGACAAGATCTTATTCGCTTATC
CCTCTTACTTAAGCTTTATTCGTGAAATTCTAAAAAATATAATAAACAAAATCTACGCTAAATTTAACTTACAATATTAC
GAAATCACTCTAGAACCACAACACTCTATCTTAGATGATATGTGGAATTTAATCGTAAAAAGCAAGCGGTTCTCAGAAGA
GAACGGAATAAGTAAAATCTTTTTACCATTTACTGCAGATTTCTTGATGGCTTACTTAATATACTCAATAACAAACCAAG
ATTATACTTATATAAAGATGATAGGATTAGAATATAATGTAAATAATATTTCATTTCTAATTCCATTTTACAACACCTCT
TTATATGAATTACAAGGCTTCTTCACTAACGAATCTAATAATATATTTGAAACGAAAGATGAAATTTTCAATGAAATTCT
AGCATGGGAAAGAGATACATTAAAAGAAAATTATGAACTATTTCATGCTTTTCATAATTCTAAAAAATTATTTGAAACGA
AAGAAAAAGAATATAGATGTGAGGGGTGTGGAGGAGTAATTAACTCCCCGGTAAAATACTGTGCGAGATGCTCTCTAATT
TACTCTTCTCCTCCTTATTGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 737914 - 739654 (Additional range around SSO0863 is :500nt.)

>Sulfolobus solfataricus P2 TGTTGTATGCCTTCTTATACCCCTCAATAATTATTGTAGGATGTATATTTTGATCCAATAAACTTTCAGCCTTCTCTAAT AGAGCACCAGCCAATACTACAGCACTTGTAGTACCATCACCTACTTCAGCATCTTGAGCTTTAGCTGCTTCTACTAATAA TTTCGCAGCTGGATGCTGAATCTCCATATCCTTTACTATTGTAGCACCATCATTAGTTATGGTTACGTCACCGAAGCTAT CAATTAGCATTTTATCAAGACCTTTAGGACCTAAACTACTCCTTAACATTTCAGCTAATGTCTTCGCAGCAAGTATATTA TTCCTTAGCGCATCTCTTCCAGTAGTTCTGCTTGTTCCCTCTTTAAGCAATAAGACTGGAGCTGCCATACCTCACAACAC CGTTCCGTGAGAACATTAGTATCGCTTATATAAAAATTTTTCTCTCAGCTAAACCGAGAAGTAATTTTTTAAATAAATAG GAAATCCATTCTCCTCTAAT ATGATGTGCGAAAGATGTAACAAAAGAAATGCCATAAACGTAGTAGGAGGAAGAAGATT ATGTGAAATATGCAGTAAAGATGAGATAACCAAGAGAATTAAAAGAGAGCTTTATCCGAGAAAGATAATAGTATATAAAG ACAAGATCTTATTCGCTTATCCCTCTTACTTAAGCTTTATTCGTGAAATTCTAAAAAATATAATAAACAAAATCTACGCT AAATTTAACTTACAATATTACGAAATCACTCTAGAACCACAACACTCTATCTTAGATGATATGTGGAATTTAATCGTAAA AAGCAAGCGGTTCTCAGAAGAGAACGGAATAAGTAAAATCTTTTTACCATTTACTGCAGATTTCTTGATGGCTTACTTAA TATACTCAATAACAAACCAAGATTATACTTATATAAAGATGATAGGATTAGAATATAATGTAAATAATATTTCATTTCTA ATTCCATTTTACAACACCTCTTTATATGAATTACAAGGCTTCTTCACTAACGAATCTAATAATATATTTGAAACGAAAGA TGAAATTTTCAATGAAATTCTAGCATGGGAAAGAGATACATTAAAAGAAAATTATGAACTATTTCATGCTTTTCATAATT CTAAAAAATTATTTGAAACGAAAGAAAAAGAATATAGATGTGAGGGGTGTGGAGGAGTAATTAACTCCCCGGTAAAATAC TGTGCGAGATGCTCTCTAATTTACTCTTCTCCTCCTTATTGA GGATAACTTCAAAATATATTTGTCCTTGAGTAGGTTT AAATCTAGACGGCGGAATAGGTCCTTCTGAAGTATAATAGAAAAAACCCGATTTTAAGATCTCATAAAATCCGTCTCGAT CCATTTTCAAAAAGTCTTGTAATATATCAATTACGTGTATGGTGTTCTTCAATTCCTTCATACTTAACATGTACCCACAG ACCCTACAAGATAAATCTGGCATTACTGAATCGAATTCACATTTAGGACATTTAATAGGAGATCTTAAGATACTTGCGAA CATTGACCAAGTTACTCGTAATAGATCTATTAAGTCTTTCCTATTTCTCTTTAAACACTCCTTATACAACTTATCCATTA TTGGAATCAGGCCACCTTTACCATAAGTCACTATAAACTCTAGCTGATCTTCACTAAGTTTCTCCACATCATATAAACGT AGTAGTTTATAAGAAATAATTTCCATTAACCTATCTCCCATAGCCTTGAGTCTATTAATTAT