SSO1019

Coordinates:878058-878894

>SSO1019 Thiosulfate sulfurtransferase (cysA-1)
MFFHIMLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVL
YSEMNNRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGIVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLI
DSRSKEEYDGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVYCRTGARASVAW
YALKEVLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

>SSO1019 Thiosulfate sulfurtransferase (cysA-1)
TTGTTCTTTCATATTATGCTTGTAAGTGTTGAATGGCTTAACAACAACTTAAAGGACGTTAAGGTTGTAGAGATTGGTTA
TAATCCGCAGATAAATTATTATGAGGGGCATATTCCGGGGGCAGTATTAATAAATTGGAGAGATTTTCTTGACGATAATT
CTAGAGATTTCGCTAGTCCGGGGAAGTTGAGTAAGGTTTTAGGAAACGCGGGGATAAACAACGATGATCTCATTGTGTTA
TATAGCGAAATGAATAATAGGTACGCATTTTACGTTTATTGGATTTTAAAGGCTTATGGACATTCAAATTTGGCTATATT
AAATGGGGGAATTTATAAGTGGTTAAAAGAGGGTTATCCTATAGAAAGCGATGGTATAGTAGTTAATAAGAAGAGTGAAT
ACAAGGCTAGGAAGCCTGATTGGTCCTCAAGGATTTTAGTATGGGAGTTATTGTCTAAACTTAAAGAGTTTGTTTTAATC
GACTCTAGGAGTAAGGAGGAGTATGATGGTCTGACTACTGCACCTCCAGAGCACAAGTGTGAACAAACCCAAATGAGTGG
TCACATTCCGGGTGCTAAGAACATTCCATGGACAATTTTGCTTAATGAAGATGAGACTATGAAATCTAGGGATGAGTTGG
AGAGAATATTTTCTTGGTTAAGTAAAGAGGATAAGATAGTGGTGTACTGTAGGACTGGTGCTAGGGCTTCTGTTGCTTGG
TATGCTTTAAAAGAGGTTTTGGGATTTAAGTTGGTCAGACTTTATGATGGTTCATGGGTTGAATATGGCAATATGGTTGG
TGTCCCAGTAGAGAAATCAGTTAGTGATCGTTTCTGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 877558 - 879394 (Additional range around SSO1019 is :500nt.)

>Sulfolobus solfataricus P2 TGTTGAATGACCAAATGAGAAGAAAGTGCCAACGAAGACTGGATTCTTTCCTTCTTGTAACATTTTCCTAGTTACGTTAT CTATTGCTGCCAAGTGATCAGCGTCTACTGCGTGTCTTAAGCCAAAGGTGTATGATAAAACTCCTAGTGTTATGAAGGTT CCTATTAGCTCACCGCTATCTGTGTTTAATGTTAGTGGTTTTTGCGGTAATGTGTATAGGAAGAGAAAAAGTAATGCTGT TAGTAATACGTTGAGTACGTAGAAAAGTGATAAGGTGACTAAATTTTTGTAACTAATTGTTTGTGTTAACGTATTGAGAA TGGATCTCATCGCATATATGGATTGTCTATCCATCATATAAATTTTTCTACTATTCTGAAGCAATCCACAAGGCAGTTAT TTCATGGTCTTGTGTAAGTTATAGTACAAGTTTTACTGGTTTCAATAACCTAAAATGCTGTAAATTGTAGAATATTTGAT TAAAAGCTTATTAACCTAAA TTGTTCTTTCATATTATGCTTGTAAGTGTTGAATGGCTTAACAACAACTTAAAGGACGT TAAGGTTGTAGAGATTGGTTATAATCCGCAGATAAATTATTATGAGGGGCATATTCCGGGGGCAGTATTAATAAATTGGA GAGATTTTCTTGACGATAATTCTAGAGATTTCGCTAGTCCGGGGAAGTTGAGTAAGGTTTTAGGAAACGCGGGGATAAAC AACGATGATCTCATTGTGTTATATAGCGAAATGAATAATAGGTACGCATTTTACGTTTATTGGATTTTAAAGGCTTATGG ACATTCAAATTTGGCTATATTAAATGGGGGAATTTATAAGTGGTTAAAAGAGGGTTATCCTATAGAAAGCGATGGTATAG TAGTTAATAAGAAGAGTGAATACAAGGCTAGGAAGCCTGATTGGTCCTCAAGGATTTTAGTATGGGAGTTATTGTCTAAA CTTAAAGAGTTTGTTTTAATCGACTCTAGGAGTAAGGAGGAGTATGATGGTCTGACTACTGCACCTCCAGAGCACAAGTG TGAACAAACCCAAATGAGTGGTCACATTCCGGGTGCTAAGAACATTCCATGGACAATTTTGCTTAATGAAGATGAGACTA TGAAATCTAGGGATGAGTTGGAGAGAATATTTTCTTGGTTAAGTAAAGAGGATAAGATAGTGGTGTACTGTAGGACTGGT GCTAGGGCTTCTGTTGCTTGGTATGCTTTAAAAGAGGTTTTGGGATTTAAGTTGGTCAGACTTTATGATGGTTCATGGGT TGAATATGGCAATATGGTTGGTGTCCCAGTAGAGAAATCAGTTAGTGATCGTTTCTGA TCTTCATTTTCTCTCAAGGTA TTTACAAAATAAAATGTCTAACTCTTTATACAGTTCTTCTGCTAATGCCTTGTCGTAGTATTTGCAATTGGCTATTAGCC CTGCTAAGCGTAATGTTTCAACTTTTGCTTCTTCTGATAGCTGAAACAGCTCGAAAGTTAACGCTGATTCTCGTGACGAT AGATTAAGCAATTGCCTTAGTAGTTCTGAGCATTCTTCCTCGTACACTCTATTGTGATCAATTGTAGTTGATATATCTTC TCTAGGTCTCTTCTCGTTTCCTCTATTCTCCTCTTCAGTTCCTCTATTCTCCTTATCTTCTCCTCTATTTTCTCCTTTAG TTCTTTTTCTTTTGAACATGTAATAGTTTCACCCCATTACAACTACTATTATTACTACAATGAGCGTCAAAATAATGTAT ATAATGTACCATGAGATTGAGCTGTTGATAAGTGTTTTAGCGAAAATCTTCCCAAATCTTCTTATTGAATTTGCTAGT