SSO1048

Coordinates:906384-907376

>SSO1048 DNA primase small subunit
MGTFTLHQGQTNLIKSFFRNYYLNAELELPKDMELREFALQPFGSDTYVRHLSFSSSEELRDYLVNRNLPLHLFYSSARY
QLPSARNMEEKAWMGSDLLFDIDADHLCKLRSIRFCPVCGNAVVSEKCERDNVETLEYVEMTSECIKRGLEQTRNLVEIL
EDDFGLKPKVYFSGNRGFHVQVDCYGNCALLDSDERKEIAEYVMGIGVPGYPGGSENAPGWVGRKNRGINGVTIDEQVTI
DVKRLIRIPNSLHGKSGLIVKRVPNLDDFEFNETLSPFTGYTIFLPYITIETEVLGSIIKLNRGIPIKIKSSIGIYLHLR
NLGEVKAYVR

>SSO1048 DNA primase small subunit
ATGGGGACTTTTACATTGCACCAAGGGCAGACTAATCTAATAAAGAGTTTTTTTAGGAACTACTATTTAAATGCGGAATT
GGAATTGCCAAAGGATATGGAATTAAGGGAGTTTGCTCTCCAACCATTTGGCTCAGACACCTACGTAAGGCATCTTTCCT
TCTCTTCTAGCGAAGAATTAAGGGACTACTTAGTTAACAGAAATTTACCACTTCATTTATTTTACTCTTCAGCTAGGTAT
CAGTTACCGAGCGCTAGAAATATGGAGGAGAAAGCTTGGATGGGGTCCGATTTGTTATTTGATATAGATGCTGATCACCT
ATGCAAATTAAGGTCAATTAGGTTTTGTCCAGTTTGTGGTAATGCCGTAGTTTCTGAGAAATGTGAGAGAGATAACGTAG
AGACTTTAGAGTATGTTGAGATGACTAGCGAGTGTATAAAAAGGGGTTTAGAACAGACTAGAAACTTGGTTGAAATTCTT
GAGGATGACTTCGGATTAAAACCTAAGGTTTACTTTTCTGGAAATAGAGGTTTTCACGTACAAGTCGATTGTTATGGTAA
TTGTGCATTATTAGATTCTGATGAAAGGAAAGAAATTGCCGAGTACGTCATGGGTATTGGTGTTCCAGGCTACCCTGGTG
GTAGTGAAAATGCTCCGGGATGGGTTGGAAGGAAAAATCGCGGTATAAATGGGGTTACTATTGATGAGCAAGTCACTATT
GATGTTAAGAGGCTAATTAGGATTCCAAATTCTCTACATGGGAAATCTGGATTAATTGTTAAGAGAGTACCTAATTTGGA
TGATTTTGAATTTAATGAGACTTTATCTCCATTTACGGGATATACGATATTTTTGCCGTATATTACTATAGAGACTGAGG
TTTTAGGTAGTATCATTAAGTTAAATAGGGGTATACCAATTAAGATTAAATCTAGTATTGGGATTTATCTTCATTTGAGA
AACTTGGGTGAGGTAAAGGCTTATGTTAGATGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 905884 - 907876 (Additional range around SSO1048 is :500nt.)

>Sulfolobus solfataricus P2 AGGGTTTAAGTTAGAGGATGTAAATGATATACTAAAACGTGTTTTAAAGGACGATACGTTAATACTATCCTCGAACGAAT CTAAATTAACACTTACTTTTGATGGAGAATTCACTAGATCTTTCGAGCTTCCATTAATTCAAGTTGAATCTACACAGCCG CCTTCAGTCAATTTAGAGTTTCCATTTAAGGCTCAACTACTCACTATAACTTTTGCGGATATAATTGACGAGTTATCTGA TTTAGGTGAAGTTTTGAATATACACTCCAAGGAGAATAAACTTTATTTTGAAGTTATTGGAGACCTCTCCACTGCAAAAG TAGAGTTGTCAACGGATAACGGTACGTTATTAGAAGCTTCTGGCGCAGATGTCAGTAGCAGTTATGGGATGGAATACGTT GCGAATACAACTAAAATGAGAAGAGCTTCCGATTCAATGGAATTGTATTTTGGTTCTCAAATTCCTTTGAAGCTTCGATT TAAATTACCGCAGGAAGGCT ATGGGGACTTTTACATTGCACCAAGGGCAGACTAATCTAATAAAGAGTTTTTTTAGGAA CTACTATTTAAATGCGGAATTGGAATTGCCAAAGGATATGGAATTAAGGGAGTTTGCTCTCCAACCATTTGGCTCAGACA CCTACGTAAGGCATCTTTCCTTCTCTTCTAGCGAAGAATTAAGGGACTACTTAGTTAACAGAAATTTACCACTTCATTTA TTTTACTCTTCAGCTAGGTATCAGTTACCGAGCGCTAGAAATATGGAGGAGAAAGCTTGGATGGGGTCCGATTTGTTATT TGATATAGATGCTGATCACCTATGCAAATTAAGGTCAATTAGGTTTTGTCCAGTTTGTGGTAATGCCGTAGTTTCTGAGA AATGTGAGAGAGATAACGTAGAGACTTTAGAGTATGTTGAGATGACTAGCGAGTGTATAAAAAGGGGTTTAGAACAGACT AGAAACTTGGTTGAAATTCTTGAGGATGACTTCGGATTAAAACCTAAGGTTTACTTTTCTGGAAATAGAGGTTTTCACGT ACAAGTCGATTGTTATGGTAATTGTGCATTATTAGATTCTGATGAAAGGAAAGAAATTGCCGAGTACGTCATGGGTATTG GTGTTCCAGGCTACCCTGGTGGTAGTGAAAATGCTCCGGGATGGGTTGGAAGGAAAAATCGCGGTATAAATGGGGTTACT ATTGATGAGCAAGTCACTATTGATGTTAAGAGGCTAATTAGGATTCCAAATTCTCTACATGGGAAATCTGGATTAATTGT TAAGAGAGTACCTAATTTGGATGATTTTGAATTTAATGAGACTTTATCTCCATTTACGGGATATACGATATTTTTGCCGT ATATTACTATAGAGACTGAGGTTTTAGGTAGTATCATTAAGTTAAATAGGGGTATACCAATTAAGATTAAATCTAGTATT GGGATTTATCTTCATTTGAGAAACTTGGGTGAGGTAAAGGCTTATGTTAGATGA ATTGGTTAAAAAGGAATTATCAGAG GAAGAAATTACTGAAATTAAGCTAGAGGAAATAATCAAGTACATCACTCTCATTAAGAAATCTAAAACTTTTGTTAGTTC TGAAATCAGAAAGGAGGAATTGAAATTTCTTTCAGAGCTGGCTGAATCGTTATTTGAGCTAAGATTGTCAAAAGTTCTAG AGGGAAAGGTCGGCAAAGGGTTTGACGAATTTATCTTCGATATTTTTAAGATATTAAAACAATTTTACGTTGATTTATTA ACTGGCAGATACATAATTTATAATGATAAAATCTATTGCATAGTACAGAAACCATTAATATATAATGATCACAGGGTTAA TGAGGGAGATGTTTTGGTTTTACCTATGAGAGAAGCCTTGCCATTAATAATAGCAAGTTATTTAACTCCCTATAAGATAG ATATTGAAGAACAATTATGAAAGTCCCTAAGGTCATCAGCACATATTGTCCAAAGTGTAAGACTCATACAGATC