SSO10830

Coordinates:2414016-2414174

>SSO10830 53 aa !not a gene!
MDSFYFGDISHRTISMGILGTWCSSSILTRDRILRFTVSYYRDNCILMASKTR

>SSO10830 53 aa !not a gene!
TTGGATAGTTTCTACTTTGGCGATATATCTCATAGAACTATCAGTATGGGGATACTTGGAACCTGGTGTTCCAGTTCCAT
TCTCACAAGAGATAGAATACTTAGGTTTACCGTTAGTTATTATAGGGATAATTGTATACTTATGGCCAGTAAAACAAGG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2413516 - 2414674 (Additional range around SSO10830 is :500nt.)

>Sulfolobus solfataricus P2 TGTTAGGATGGCATATATTGTTGGTATTTCTACTGGGAGTTCTATTCCTATTTCACTTCATGTTAGCGGAGAGATATGGA ATGACACCCTCAGCTAGGGATAAACCTAAAGTCCCCGCATACTACACGAAAGAAGAACAGCAGAGATTTAATGAATGGTG GCCTAGAAACTTTGTTTATATGTTATCAATCGTATTATTAACATGGGGTATAATACTATTTGTTCCTAACTTACTAGCAA ATATCAATGGATTACCAATAGTTATAAATCCTTACCCGGCCCCACAAGCGGGATCACCAGAGTCTACCAGTGTACAACCA TATCCCCCATGGTTCTTCTTATTCCTCTACAAGTTTGTTGACTTCCTTCTACCTAATGGAATGCCAATAACTCCAATATT GGTTTTAGCAGTTCTCATTATAGGTCTTCTAATTCTAATATTCCTTCCCTTCTTGGATCCCAGTGACGATTTACGTGTTA CTAAAAGAAAGTTCTGGAC TTGGATAGTTTCTACTTTGGCGATATATCTCATAGAACTATCAGTATGGGGATACTTGGA ACCTGGTGTTCCAGTTCCATTCTCACAAGAGATAGAATACTTAGGTTTACCGTTAGTTATTATAGGGATAATTGTATACT TATGGCCAGTAAAACAAGG TAATACCCCAGTTTCAAAATCTGAGACTAAAGTAATTAAAATGAACATTACTCCTATGGA AATACTGTTAGCTAGTGTATCCTCCTTATCCTTGGCAGGAACATTTGTAAACTTCTTAGAATTTCCTACTGTCGTGAATG GAATCATTTTAATACCAGTTATATTACTTACAATATACATGTTAAGAAGAGTCGCCGCTTTTATACTTGGGAGAAAACCA GTAGCCGCTATAGGTAACAATATAGCGACCAGTTGGAGCAAGAAAGCCGCATTTTATGGAATTATAATAATTTTCATTGT TTCCTTATTATTATTGGGCCTAATGTGGACCTTACCGAGTATAGGACCGCAGTCAACGTATGCTGGAATGGACCTAGGCG TAATCTTAATGCTATGGGGGATAGCAGTTCAACTTTATCATTATGAAATTTATGTTAAATAGTGGGGTGGGATAAATGAA TAAGTTAGGTATTGCAATTTTGGCTCTAATATTCGGAGCT