SSO10833

Coordinates:2415424-2415549

>SSO10833 42 aa !not a gene!
MDENWDDMVDCTIFRCRIYDVSNWLSRNAEKNDSVSISISTL

>SSO10833 42 aa !not a gene!
ATGGATGAGAATTGGGATGATATGGTGGACTGCACCATTTTTAGGTGTAGGATATACGATGTCAGTAATTGGTTATCTAG
GAATGCTGAGAAGAATGATAGCGTATCCATCAGTATTTCAACCCTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2414924 - 2416049 (Additional range around SSO10833 is :500nt.)

>Sulfolobus solfataricus P2 CATTCCCGTTATTTGGTGCATTATACTACTATATTCCGAAATATGCTGGAAGATCTCTCTTCAGTGAAAAGTGGGCTAGA TGGAATATATACTTGCTATCAATAGGCTCAATGCTTATATGGGTTCACCACCTACAAACATGGCCATTACCAATAGACTT GAGAATATGGGTAAACTTATCCACATTAATTTTAGCCTCGGGATCTGGTCTTACCGTATTGAATTTGGGACTCACAATAC TTCTTTCTCAAAAATATAATTGGAAAGATCCAGTAGGAATGGGAGGACTAATTGCATTAGTAGGATTCATATTAGCTGGT GTTCAAGCACTCGTTTTACCAGAGAATTCAATAAATCCACTATTCCACAATACCTATTATGTAGTAGGACATTTCCACTT AATGATATGGACTTTAATAGTAATGGGCTTCACTACAGTATTTTTGGATATGCTAAAAAGCACATTTGGTGGGTTCAACT TTAGCGAGCAAGCCTCTAA ATGGATGAGAATTGGGATGATATGGTGGACTGCACCATTTTTAGGTGTAGGATATACGAT GTCAGTAATTGGTTATCTAGGAATGCTGAGAAGAATGATAGCGTATCCATCAGTATTTCAACCCTA TAACCTATTGGAA TCAATGCTAGCTGAAATAGGGATTCCGGGACTATTAGTCACAATCTTTGTGGCAATTGTCGATGCATTGGCTTATGCTTC TAAACAAGGTATTTTTTCATCTCCTTCTCCCTCAACTTCTCCCTCTAATTTACCCGTAATGGCTAAAGATGGGGTGAAAA ACAATGGGTGAGGAAAAAAAAGGTATTATAGATACGATAATTGATAGAGTAGGTGTAACTGAAGCGCCATTATTTAAGAC ACCGGATTACATGTATAATATATCCTATTGGCTAGGTGCAATGGTAGCTGCGGCTTTCATATATACTGTTATAACTGGTC TATTCCTCTTAATGTATTATCAACCAGCCTACGCGTACCAGTCAACACAAAGTATAATTTCCAGCGTTCCGTATGGCCCA GTCTTATTATTTAGTCACTTATATGGAGCATACATTATGATTATCTTGGCATATATACACATGTTCAGAAACTTCTATAA GGGGGCT