SSO10838

Coordinates:2416219-2416347

>SSO10838 43 aa !not a gene!
MFSLSFFGFVAYASAISIMNIAVCSMKAKVKDRYAIPIRAGVV

>SSO10838 43 aa !not a gene!
ATGTTTAGTCTTTCATTTTTTGGCTTTGTTGCATATGCATCTGCAATAAGTATTATGAACATTGCAGTCTGTAGTATGAA
AGCTAAGGTTAAGGATAGATATGCCATCCCCATTAGAGCTGGTGTAGTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2415719 - 2416847 (Additional range around SSO10838 is :500nt.)

>Sulfolobus solfataricus P2 GTGCTTGAACACCAGCTAATATGAATCCTACTAATGCAATTAGTCCTCCCATTCCTACTGGATCTTTCCAATTATATTTT TGAGAAAGAAGTATTGTGAGTCCCAAATTCAATACGGTAAGACCAGATCCCGAGGCTAAAATTAATGTGGATAAGTTTAC CCATATTCTCAAGTCTATTGGTAATGGCCATGTTTGTAGGTGGTGAACCCATATAAGCATTGAGCCTATTGATAGCAAGT ATATATTCCATCTAGCCCACTTTTCACTGAAGAGAGATCTTCCAGCATATTTCGGAATATAGTAGTATAATGCACCAAAT AACGGGAATGGAACGTAATATACTACTGGATGCCCATAGAACCAAAATAGCAATGCCCACAGTAATGGGTTCACTGGAAC TCCTGCAAAGAAATACAGTGTGTACCAAAGCGTTGATGCAGCAAGAGCGGGAAGCGTTATTGCAATAACTATTGCAAAGG CTACTCCATAAGCTCCAAAA ATGTTTAGTCTTTCATTTTTTGGCTTTGTTGCATATGCATCTGCAATAAGTATTATGAA CATTGCAGTCTGTAGTATGAAAGCTAAGGTTAAGGATAGATATGCCATCCCCATTAGAGCTGGTGTAGTA TAGAATAGA AAAGCGTGGAAGTTACTACCAGACTCTATCGCCAATGGAGGGTACATATACCAACCCATATCTGGTGATCCAGCTAGTCC AATCGCTAAGAAGATATTAGACAACCAGAAGAAAATTGCCATTAACTTAGTGTGAACTATAGATAAGTTACTCTTATACA TTGCAAATGCTATAACAGCAGCTGCAGCTAAAGGTACAAATCCGAACATACCAGCCCAGCCGTGAATGGTTAATGCACTG TAGTATAGTTCTCCCACGTTGGGGGAATTACTATTATATGTCAAGTACGTTCTCAGATTCATGGCTGCTATTCCCAGAAC TCCTAGCCAGAATATAGAACCTATAGTGTAAAGCCAAACTACGTTTAACGTATTTTTAGGGATAACAGTATCCTTTATCT GATTTAAAAGTTGGCTCATGATACCACCTCCAAAGTTCCAGTCATGTATGATGAAGAGTAGCCATCATATTCCGCATTAT ACCATGTGTA