SSO10844

Coordinates:2419145-2419324

>SSO10844 60 aa !not a gene!
MRPYPYNLLPKQVNLHLISQRELHRISALLKALLEEKDYTQQVAYPQRKGLVILLSHQQR

>SSO10844 60 aa !not a gene!
TTGCGCCCTTATCCTTATAACTTACTGCCGAAGCAAGTAAACCTACACTTAATATCGCAACGAGAATTGCACCGTATAAG
TGCATTATTAAAGGCACTCCTTGAAGAGAAAGATTATACACAGCAAGTAGCATACCCCCAGCGTAAAGGATTAGTAATAT
TGTTATCTCACCAGCAGCGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2418645 - 2419824 (Additional range around SSO10844 is :500nt.)

>Sulfolobus solfataricus P2 CTGGAATTAACAAGCCATAAAAAGCTAATCCACCGGCAGCTGCTATGCCTATAAACAATAAATTTAGTAAAGAAAATAGA TATACTGATCTTATACCTTCTCTAACAGACTGAGCAAGCATAGCAGACCCAAAAAACCCTACAAGCATGGCAAGTGTTAT ATGACTTGATAATATCAAAGCTTCCGAGTAGGCATTTAGTGGGAATTTATCGTAAAATAGTGTGGCTAATCCTGCATAAA ATAATCCAGCTAAAAGTATAGTTTCAGTTAGTGATATATATAACATCAACCTACTTGGTCTTATTCTAGATTGTGAAACT GCCAATCTACTCACCTCTTCTAATACTATATACTAAACAGCCAGAAGCGGTTATAAGTGCAAATACAAAACCCATTCCCA TTTCGAGCAAATAGCTCACGTCTATTACACCTCCAAAATAAAACGACCCAGCAAAGGCTGCTAAAAGAACCGAGAGAACA TTTAAAAATGAGAGCATAA TTGCGCCCTTATCCTTATAACTTACTGCCGAAGCAAGTAAACCTACACTTAATATCGCAA CGAGAATTGCACCGTATAAGTGCATTATTAAAGGCACTCCTTGAAGAGAAAGATTATACACAGCAAGTAGCATACCCCCA GCGTAAAGGATTAGTAATATTGTTATCTCACCAGCAGCGA TAGCCGGCATATAGTTCATTCTAGACATCATCTTGCTCA TCTGGATATATTTCTCATACATCATTTCTATAGCTCCCAAACTTGTCACCTCATTGGTAGGTGTTTCCAGCGCTCTCAAG CTCAGTGTAGCAATTACTAGGTGTTTGACCAGATTGTAATAGCATTTTTGGACAGCCAGTTGATTCATCATATGAAGATA GATACGCATACCCTGAAAGATCGTTAGTACGTCCTAATATCGTGGGAGCATTTAAGTTCATACCTATTGCGTACAAGTAA TCAGTATTAGAATCCCAATACAACTGTACGTACGGTAACGGTCTAACTGTGGGTCCAGTAAGGACTGAGGCACCATGATA AGGATCATAAGTAGATCCGTGACAGTCACAGTGTATAACTCCAGGGGCATTGGCTTGTTGGGCTGCTTGAAGTGCAACTT GTGGTAAAAAATTGGGAGTAGGCAAACCAACTTTCATATACTTAGGAGGATAGAAGTGTAT