SSO10847

Coordinates:2419773-2419919

>SSO10847 49 aa !not a gene!
MIMSKKFKLRKIKPTMYKIGSRRTLVPLSMHSLELTSHKKLIHRQLLCL

>SSO10847 49 aa !not a gene!
TTGATAATGTCAAAAAAATTTAAATTGCGTAAAATAAAACCGACGATGTACAAAATAGGGAGCCGAAGAACCCTAGTGCC
ATTAAGTATGCATAGTCTGGAATTAACAAGCCATAAAAAGCTAATCCACCGGCAGCTGCTATGCCTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2419273 - 2420419 (Additional range around SSO10847 is :500nt.)

>Sulfolobus solfataricus P2 GAATATTTGTTGGTTATAAGTACTTTAAGGGGGATATAATTTCCCTAATCCTTGGGTTAATACCACCTATCCTTTGGCAC TTACCATATTTTTTTGCAATAGGAGCTGCTTTCATAACATATAGAGCAATTCTAGAAATAACGCTTCTTACTGGTGGAAT CCTTGTCGGTTCCTCCATCAGATACGTGAAGTTTTACCTAAAAGTTACATTATTTGCACTTTGGATGTTAGGGGATAGTG CACTCGCAATTATATTTATAGTGTCGAGCCCCCTATATTCAAATATTGTATATAAGTTCTCTCCATATTCTCCATCAACT CTCCCAATTGCTGGAGTAGCTATGTTCATAGCGATGAACGTATTTCTAGGATATGTCATAGCTAGATATATAAAAGGAAT AATAGGATGAGCTATATAGGCAATGGTAGCTGATACTTAAAATTCTACCGTAGGATTTGTTACCGAATATCGAAGAGCTT CTGCCAAATATTTTAAAAA TTGATAATGTCAAAAAAATTTAAATTGCGTAAAATAAAACCGACGATGTACAAAATAGGG AGCCGAAGAACCCTAGTGCCATTAAGTATGCATAGTCTGGAATTAACAAGCCATAAAAAGCTAATCCACCGGCAGCTGCT ATGCCTA TAAACAATAAATTTAGTAAAGAAAATAGATATACTGATCTTATACCTTCTCTAACAGACTGAGCAAGCATAG CAGACCCAAAAAACCCTACAAGCATGGCAAGTGTTATATGACTTGATAATATCAAAGCTTCCGAGTAGGCATTTAGTGGG AATTTATCGTAAAATAGTGTGGCTAATCCTGCATAAAATAATCCAGCTAAAAGTATAGTTTCAGTTAGTGATATATATAA CATCAACCTACTTGGTCTTATTCTAGATTGTGAAACTGCCAATCTACTCACCTCTTCTAATACTATATACTAAACAGCCA GAAGCGGTTATAAGTGCAAATACAAAACCCATTCCCATTTCGAGCAAATAGCTCACGTCTATTACACCTCCAAAATAAAA CGACCCAGCAAAGGCTGCTAAAAGAACCGAGAGAACATTTAAAAATGAGAGCATAATTGCGCCCTTATCCTTATAACTTA CTGCCGAAGCAAGTAAACCTACACTTAA