SSO1085

Coordinates:941457-942194

>SSO1085 Glutaconate CoA-transferase, subunit B (gctB)
MKSYNVDYVIKAISTLLEDGELVYIGLNSIPSLIASFMARDLYRKKIRIIGVAEASNPSRVVLSPSTGNPFFVEASPVMI
TADAFDLAQKGKLDVMFLGPAQIDEETNVNLTMIGNEYHNPKVKLPGGAATAFILPLSRKAILWNLKHSKRSLVRRVDFI
TGTAKFSNNKVFVVTNLGVLAYNREERKWYLEAIYPFSSYEKVVENTDFEVKRKDSERLIDLTDEDLRFINYMDPYNLRS
ALETL

>SSO1085 Glutaconate CoA-transferase, subunit B (gctB)
ATGAAAAGTTACAATGTAGATTATGTCATAAAGGCTATTTCGACATTATTAGAAGATGGAGAATTAGTCTATATTGGCCT
GAACTCAATACCTTCACTAATTGCGTCTTTCATGGCCAGAGACCTTTACAGAAAAAAGATAAGAATAATAGGAGTAGCAG
AAGCCTCAAATCCATCAAGAGTAGTATTATCGCCATCTACAGGGAACCCATTCTTTGTGGAAGCCTCTCCAGTTATGATT
ACTGCTGACGCATTCGACCTCGCACAGAAAGGTAAACTAGATGTCATGTTCTTAGGTCCAGCACAAATAGACGAGGAAAC
TAATGTAAATTTAACTATGATTGGAAATGAATACCATAATCCTAAAGTTAAATTACCAGGTGGAGCAGCTACAGCATTTA
TCCTACCTCTTTCTAGAAAGGCAATCTTATGGAACCTAAAACACTCTAAAAGATCTCTTGTCAGAAGGGTGGACTTCATA
ACTGGAACAGCAAAGTTTTCAAATAATAAAGTATTTGTGGTGACTAATTTGGGAGTTTTAGCATATAATAGAGAGGAAAG
GAAATGGTACTTAGAGGCAATCTATCCATTTAGCTCATATGAGAAAGTAGTGGAGAATACTGACTTTGAGGTAAAGAGAA
AAGATAGCGAAAGGTTAATAGATCTAACTGATGAAGATTTGAGATTCATTAATTATATGGATCCTTATAACCTTAGAAGT
GCTCTAGAAACTCTATAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 940957 - 942694 (Additional range around SSO1085 is :500nt.)

>Sulfolobus solfataricus P2 ACGTTAGATAAATTTGATTATAACACAATACTTGATTTGAAAAATTGGTTAAAAATTGATGATAGATTATTGAAATTAGC ACTAAAGAAAAGTAAATTTAGGGTTCATCTCCCCTAAATGTATAGATGCCCTAGATTTTTATATCAATCAAACTCTTCTT GAATCTTCTTCCTCCCTTCAATAAACTTTCTGGGGAACGGGATTTCCTTAACTTCTTCTATCTTAATACCACTGCTTCGT AACTCCTCTATCGCCTTTTTTAGATCTTCCTCATGAGTAGCATACTTTACCGCTTCTTTCACCTTGTTAATAGAAGGGTC ATTGCTCCTAAATCTTTCCGCGCTAACACTAACCCAATTATTATTGTTCTTATAAACGAAAACAACATCTTGTAAATATC CTTGAATTACGTGCTCTACACCAGCTATGTAATAATCACCTATCTTGTAAACCTTTACCATCAATATCTTTAATAACGCG TAAAAACTTAAAATTATTC ATGAAAAGTTACAATGTAGATTATGTCATAAAGGCTATTTCGACATTATTAGAAGATGGA GAATTAGTCTATATTGGCCTGAACTCAATACCTTCACTAATTGCGTCTTTCATGGCCAGAGACCTTTACAGAAAAAAGAT AAGAATAATAGGAGTAGCAGAAGCCTCAAATCCATCAAGAGTAGTATTATCGCCATCTACAGGGAACCCATTCTTTGTGG AAGCCTCTCCAGTTATGATTACTGCTGACGCATTCGACCTCGCACAGAAAGGTAAACTAGATGTCATGTTCTTAGGTCCA GCACAAATAGACGAGGAAACTAATGTAAATTTAACTATGATTGGAAATGAATACCATAATCCTAAAGTTAAATTACCAGG TGGAGCAGCTACAGCATTTATCCTACCTCTTTCTAGAAAGGCAATCTTATGGAACCTAAAACACTCTAAAAGATCTCTTG TCAGAAGGGTGGACTTCATAACTGGAACAGCAAAGTTTTCAAATAATAAAGTATTTGTGGTGACTAATTTGGGAGTTTTA GCATATAATAGAGAGGAAAGGAAATGGTACTTAGAGGCAATCTATCCATTTAGCTCATATGAGAAAGTAGTGGAGAATAC TGACTTTGAGGTAAAGAGAAAAGATAGCGAAAGGTTAATAGATCTAACTGATGAAGATTTGAGATTCATTAATTATATGG ATCCTTATAACCTTAGAAGTGCTCTAGAAACTCTATAA TTTTCTCGTAATCTGCATCATAAAGTGGGAACATACTAGTC GGCTCTGCACCCTTTGGTGCGTGAACCACAGCAGTAACGTATTCTCCATTAATAGTCGGTCTCCTACCATAGAAGTAAGA TCTAGGAACTATCTCTTCGGCAGTTATTATCACCTTTTTGGCTGCTTTAGCCTTGTACTCATCTTCATATAGTGGACCTA GGATTTCCGCATTTCCCTCTTCATCAGCCTTATTTACATGTATTATTGCAACATCTGGGTTGATAGCCTTTACGAGTACA ACTTTCTCTCCACTAAATGGATCCTCGACAACTTTCCATGTACCTTCTCTTTCATGAATTTTAACTAGATCAGACCCTAT TATTCCCCTAACCGGCATAAACGGTATACCGAAGCTCCCTGCTCTTATCCCAGCAATAAAAGCACCACAAGTATCTTCCA ATATTTCAACCTCTCTTTCTTCGGTCATTTTCCTAAAATGCTTTGGAATACTCGAGAAC