SSO10852

Coordinates:2421964-2422131

>SSO10852 56 aa !not a gene!
MVSVTPPILYRSACKKSTNPSFIKYKACCLLIILSPNAILKLVLFLYFLSPSTSSG

>SSO10852 56 aa !not a gene!
TTGGTCTCAGTAACTCCACCAATTCTGTATAGATCAGCTTGTAAGAAATCCACTAATCCCTCTTTCATAAAGTATAAGGC
TTGCTGTTTATTAATTATCCTTTCACCTAACGCAATCCTTAAGCTCGTATTGTTCCTATATTTTCTAAGTCCTTCCACAT
CCTCAGGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2421464 - 2422631 (Additional range around SSO10852 is :500nt.)

>Sulfolobus solfataricus P2 TACTCTGTTGGGAAGAATGGGAAGGATGATCGAAATATCCCATTTATTAGCCTTTTTAGCTTCAGATTTGAATAGCTTCA TCACCGGAACGGAAATTATAATTGATGGAGGTAGAATAATAAGCAGAAAACCGGATCCAGAAGAAATTACCAAGGGCGAG ATATAACTAATAGTCTCTCCAAGTTCCTTTAACTACCCACACTGGTTCTTCTGGATTAAAGTACTCCTCACCTTTAACCT TTAAACTATCTAACATTTTCTCATTTACTTCAACTCCTAAACCCGGTCTTTCCGGTATTATAGCGTATCCGTTATCTATT GGAGTACCATTATATATTAGCTCCCTCTTCCAACTCGGGAACCAATCATAGAAAGACTCTTGTATTAAGAAGTTTGGTAT AAATGCGTCAAACTGTAGTGTTACGGCGTTTAGTATTGGACCTTGAGCATTGTGAAAAGCCATCTGTACGTCAAAGGTCT CAGCAATCCCTACTACCTTC TTGGTCTCAGTAACTCCACCAATTCTGTATAGATCAGCTTGTAAGAAATCCACTAATCC CTCTTTCATAAAGTATAAGGCTTGCTGTTTATTAATTATCCTTTCACCTAACGCAATCCTTAAGCTCGTATTGTTCCTAT ATTTTCTAAGTCCTTCCACATCCTCAGGA TGAATTGGTTCTTCCATGAACAATGGATTATACTTCTCTAGTCTTTTCGC TATCATAATAGCCGAATTCGCATTAAACCTACCGTGATGCTCTATTAAAATATCCACGTTGTCTCCAACTGCCTCTCTAA CAGCCTTTACTCTCTCCTCAGCTATATCTAGTCCTTTCTTTGAAATATCGTTAAAGTACGGACCAAATGGGTCAAATTTC AAAGCCTTATATCCCATTTTTACGATCTCCTTAGCTTTTTCCGCAAAGTCCTCTGGCTTCACGCAGTTTTGATACCAACC ATTAGCGTAGACAAGTACTTTATCTCTTGTTTTTCCTCCAAGCAGCTTATATAATGGAGCACCTAACTCTTTTCCGATTA TGTCCCAAGAAGCTATATCTACTGCACTATAGGCTGTTGTAGACTCTAAGGAGATAGTCATATTGAAATCATGTTTATAC CATTCTAGCCTGTTCTTTTCAACGTTAAACACGTCATTTCCTTTTAATA