SSO10855

Coordinates:2422655-2422816

>SSO10855 54 aa !not a gene!
MPQLLPLRHLQFLPSLLYHRLWLPLPVPLMKPIERLLLPYLKCTLRFLKSLSCM

>SSO10855 54 aa !not a gene!
TTGCCACAGCTTCTGCCCTTAAGGCACTTACAGTTTCTCCCCAGCCTACTCTACCATCGTTTGTGGTTACCCTTACCAGT
ACCATTAATGAAGCCCATTGAGCGCTTGTTACTTCCTTACCTAAAATGTACGCTTCGATTTCTGAAATCTTTGTCATGTA
TG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2422155 - 2423316 (Additional range around SSO10855 is :500nt.)

>Sulfolobus solfataricus P2 TGGATTATACTTCTCTAGTCTTTTCGCTATCATAATAGCCGAATTCGCATTAAACCTACCGTGATGCTCTATTAAAATAT CCACGTTGTCTCCAACTGCCTCTCTAACAGCCTTTACTCTCTCCTCAGCTATATCTAGTCCTTTCTTTGAAATATCGTTA AAGTACGGACCAAATGGGTCAAATTTCAAAGCCTTATATCCCATTTTTACGATCTCCTTAGCTTTTTCCGCAAAGTCCTC TGGCTTCACGCAGTTTTGATACCAACCATTAGCGTAGACAAGTACTTTATCTCTTGTTTTTCCTCCAAGCAGCTTATATA ATGGAGCACCTAACTCTTTTCCGATTATGTCCCAAGAAGCTATATCTACTGCACTATAGGCTGTTGTAGACTCTAAGGAG ATAGTCATATTGAAATCATGTTTATACCATTCTAGCCTGTTCTTTTCAACGTTAAACACGTCATTTCCTTTTAATACAGT ATTTATCTTTTTTACAAAAT TTGCCACAGCTTCTGCCCTTAAGGCACTTACAGTTTCTCCCCAGCCTACTCTACCATCG TTTGTGGTTACCCTTACCAGTACCATTAATGAAGCCCATTGAGCGCTTGTTACTTCCTTACCTAAAATGTACGCTTCGAT TTCTGAAATCTTTGTCATGTATG TAAGTAAAGGTTTGGAAAAATAAAGTTTTTATCGGCTACACAATAGGGTATATACT GTATGAGAAGGAGGACAATTTTAGCAATCTCAATTACAATACTAGCTATAGGCTTGATAGACGTACTTTTCACTTACCTT TACTCATCTCTAGTGGTATATAGTCTTAGAGATAATTTTTCCTTAGCTGAAGAAGGAGCACAAAGTTTTCCAATTTTGGT TAAACAAAATGATAAAATAATAATCGAAGGGAATTCTTCGAAACCTATTGATATTTATATTATAGGGATCGTACCCCAAA AGGTTGCAAATAACGTGAGTTCGTTTAGTATATCATATGTTTCCCCAAATACTGGTGAGCTTTATATTCAATTTAGATCT CTTCCGTATTCTAACTTAACTACCATTTCATTTACTATAAAAGTTTTCAACTCTTGGTTCTCGGGTATTGGCTATTTATC TTCAGCAATTATACTATTTGTTGGACTTATACTTCTTGGTTAC