SSO10872

Coordinates:2430151-2430282

>SSO10872 44 aa !not a gene!
MSMNINHSRYYIFTSIYFYFLIADSTSNFPYFTIRYYYVIPKTF

>SSO10872 44 aa !not a gene!
GTGAGTATGAATATCAATCATTCCAGGTATTACATATTTACCTCTATCTACTTTTATTTCCTCATTGCAGATTCCACTTC
CAATTTTCCTTATTTCACCATCAGATATTACTATGTCATCCCTAAAACTTTC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2429651 - 2430782 (Additional range around SSO10872 is :500nt.)

>Sulfolobus solfataricus P2 CGTATATCGGAGAAGTTAACGAAACACCAATTATTCCGGGATCTCTATGATGGAATGGCCTCATAGCATTGAACAAATGT GTAACTGATGATGCTCCAAAACCTATAGCTCTTCTGGTATCATCTGAATTAGCGTCCGTATGACCTAAAGAAACTTGAAA GTTATCCGCTAAATTCTCTAATTCTTTATCACTCAAAATCTCTGGTGCTATAGTAATTCTCTTTATTTTAAAGAGTTTAG AAATTTCTAAAATTCGTTCGTCGAATCTAGTAAAGAATTTATGTGCACCAGCTCTATTCGGATTTATTAACGGTCCCTCA AGGTGTATCCCAATACTTTTAACTTCATTTAAAACCCTTGCTATACTCACTAATTTTTCAACATTTTCAGAAATTGTTGA TGGAATGAAAGTGGTTACACCATGTGAATAATAATAGGATACCATTTTCTCATAGTCATTAATACTTCTAATGTCATTTA CAAGAATTCCCCCTATACC GTGAGTATGAATATCAATCATTCCAGGTATTACATATTTACCTCTATCTACTTTTATTTC CTCATTGCAGATTCCACTTCCAATTTTCCTTATTTCACCATCAGATATTACTATGTCATCCCTAAAACTTTC TAATGGG GTTATTATCTCTAGTCCTCTGATACACTTACTCACTTTCACCCACCTTACCGTATAAGAAACACGCAACTTCATGCGAGT ATTTAAATAATTTGGGCTCTTCATTTTTGCATATATCCATTGCAAAAGGACATCTTAGCCTATATGGGCATCCCTTTTCT ACTCTCTCGTAATTTATCTTAACGTTAATCTCTTTATATAGATTATCAATAGATGGTGTGAGCTTTATTAAATCATTAGT ATATGGATGTAATGGATCCTTTAATATTTCCTCTAAATCGGCTCTCTCCACTATCCTACCCGCAAACATAACTATTGTAT TACCCTTGTCAAATAGATGATAAAAGTATCTGGCTATTGGAATATCGTGAGTTATGAATACCATCGTAAGATTGAGTCTA TTCTTTATTTCAGCTAATGTATTTAATATTCCAATCCTCAGCGAGGCGTCCACCATTGTCACAGGCTCATCAGCAACTAT TATCCTAGGATTT