SSO10875

Coordinates:2432342-2432461

>SSO10875 40 aa !not a gene!
MYKLFTNASFNHSTFSSIPKSGSNLRAYSATSIESLKKFS

>SSO10875 40 aa !not a gene!
ATGTACAAGCTATTTACTAACGCATCTTTTAACCACTCCACTTTCTCTTCTATTCCTAAATCTGGTTCTAATTTGAGAGC
GTATTCTGCAACATCTATAGAATCTTTAAAGAAATTTTCG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2431842 - 2432961 (Additional range around SSO10875 is :500nt.)

>Sulfolobus solfataricus P2 CGGTCAATGCTGAAAGGAACATCGATGCTATATAGGATGAGGCTCCGTACATGTGAGTTCCGTCATAGGAGTTATCGTAA CCACCCTTTGAGTCCGGTATACAATCGTTATCCATATCTTTTCTTATGAGCCAATCAATTATCTCCTTTATTTTATTATA GTTCTTCTCCAAAATTTCCCTATTAGAGGTAAACACGTAGTCTCTGTATAACATTAGGACTAAAGTAGGTCCCAAATCTG TCCACCAATATGGATATGACGCACCGTAAATTGGATCTTCAATACTTTCCTCTCCAACATCATGTGGCGTTTCCCCATAA TTTACATAGTTCATAAAGTAATTATCAGCTGATATTACTAAATCTCTGTAAAGTTCTAAGAGAGTAAATCCGAGACCATC AAAGGTCATAGAACCAATCGTATTCATTAATTTAGTAACGAATGGATCTTCATATACAGCGAATCTTCCATCTTTAGTTA ACCAAGTATTTGATGTTAGT ATGTACAAGCTATTTACTAACGCATCTTTTAACCACTCCACTTTCTCTTCTATTCCTAA ATCTGGTTCTAATTTGAGAGCGTATTCTGCAACATCTATAGAATCTTTAAAGAAATTTTCG TAGTAATGTCCATATGGA TAGTGATAAGGTCTTCCGTTAAAATACCATGAAAGGATAAACGTTTCTTCTTCATCCACATCTTTATATACAATACCCCC TATTTCTTCTCTGGCATATGGTTTTATTACATATGTTTCATCATATTCTTCTAAATTATAAAAATATGTGATATCTTCAG TCATTCCGACCTTAGCTGGTTTATAGTAAGCGTAATTGGTTATAACCTTACAGCCAATACATCCAAGGAAAATTTCTCCA TAAGCTGGATCAGAATTTAAGGCCTTCTCGTTTTTCATCACTACACCATTTAACTTTCCCTTATAGCTCTCATTTGCTCT ACCAGCTCTCTTACTTCCAACTATATTCGGAAAAGAAATTGCAAATCTTCCTTTACCTTTTATTCTAAACTTTATTACTG GGAGGGATGAATTCTTAACGTCATTTTTCCGTAGGATTGAATACACTTCTATTTCAGCTAGAGGTGTCGAATATCTGATA A