SSO10877

Coordinates:2433953-2434105

>SSO10877 51 aa !not a gene!
MLLALWRIGVLLPLGRLLCWLMILLQFLKSLELLRLLLMSWLISGLVIWLL

>SSO10877 51 aa !not a gene!
TTGCTGCTGGCGCTATGGAGAATTGGGGTGCTATTACCTTTAGGGAGACTGCTTTGCTGGCTGATGATTCTTCTTCAATT
TCTCAAAAGTTTAGAGTTGCTGAGGTTGTTGCTCATGAGTTGGCTCATCAGTGGTTTGGTAATTTGGTTACTT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2433453 - 2434605 (Additional range around SSO10877 is :500nt.)

>Sulfolobus solfataricus P2 GATTGAAAGAGAACTTGAGATAAAGTTTAAAGGAAAAGCCTCTCGGGATTCAATTTTAGGGATTTACGTTGCTCCTTATG ATGGTAAAGGAATGATTACAACGCAATTTGAGGCAGTATACGCTAGGAGATTTATCCCATGTTTTGATCATCCTGCAATG AAAGCTAGATTTAAACTAAGCGTTAGGGTACAAAAGGGACTAAAGGTAATATCTAATATGCCAGTTGAGAGAATAGAAGA GGATGTGGACGGTAAGGTAATTTATCGTTTTCAAGAAACTCCTAAAATGTCTACGTATCTATTATACTTGGGAATAGATG AATTTGAGGAGATTTCTGATAACTCTAAACAACCTACAGTAATATTAGCCACAGTACCCGGAAAATCAAAAAGAGGACTA TTCGCAATTAACGTCGCCAGAAAGGTCATTGAGTTTTATGAAAAATACTTTGAAATACCTTATCAGTTACCAAAAGTTCA TTTAATACAAGTTCCCGAGT TTGCTGCTGGCGCTATGGAGAATTGGGGTGCTATTACCTTTAGGGAGACTGCTTTGCTG GCTGATGATTCTTCTTCAATTTCTCAAAAGTTTAGAGTTGCTGAGGTTGTTGCTCATGAGTTGGCTCATCAGTGGTTTGG TAATTTGGTTACTT TGAAGTGGTGGGATGATTTGTGGTTAAACGAGAGCTTCGCAACATTCATGAGCTATAAGAGTATA AAGCATTTATTTCCCCAATGGGATAGTGAAGGTCATCTTATTTATGACGAATCTATAGGTGCTTTAGAGGATGACTCTCT TTCTACTACACATCCAATAGAGGCACATGTAAAAGATCCCCATGAAATTGAACAAATGTTTGATAATATTAGTTATGGTA AGGGGGCTAGTATTTTAAAGATGATTGAGGCTTATGTTGGTGAGGAGAATTTCAGAAGGGGGGTTGTCAATTACTTAAAT TCTTTCAAATTCGGAAATGCAGAGGGTAAGGATTTGTGGAATTCTATTTCTAACGCAGCTGGGCAGAGTATTGGAGAAAT TATGGCTGATTGGATTACAAAGCCTGGTTACCCTGTAATTTTTGTCAACGCATACGGTAATTCTATCAGGTTTTCTCAAA AAAGATTTACACTTCTTGATAGCGGTTTAAATGA