SSO10883

Coordinates:2437960-2438094

>SSO10883 45 aa !not a gene!
MLVTKLNCPLVIFGLIIITFPGLKITPFLFNEPLVKISKSLTGNV

>SSO10883 45 aa !not a gene!
GTGTTGGTTACGAAACTTAATTGTCCGCTAGTTATATTCGGTCTTATAATTATTACATTCCCCGGACTCAAAATTACTCC
ATTCCTATTCAATGAACCATTGGTAAAGATTAGCAAATCTTTAACTGGAAATGTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2437460 - 2438594 (Additional range around SSO10883 is :500nt.)

>Sulfolobus solfataricus P2 AAAGACTAGTTACGTGGAAAGTGATTATGTAATCCTGAGCAAAGTTAATTGATCCGTATTTGTAGTAAATATACGAGGTA TTGTAGGATATGTTAAAACTACCAACTGTTTTATTATAATGGTTGCCAATCGCGTAAACTTTTCCACTCCAGTAACCATA ACCAGGATATATAATATATGAATTGTTATCCTTTAAATCCAGAGCTTTTATGAAAGTAACATTTTCGAAATAGGCTATAC GAACTTGGTAATAATTAGCTTGGACTTTGCTAGGGCTATTAACCATTGGCTGAAGTGTGTAATTATATAGTGGTGGCGTG GAGTTGAATATCAGTTCAACACTTGTTATGTTTTGAGGTCCTATTAAATGATTATTTGTTGTCCTTATTGACAGAATGTT CTCATTCCCTAGACTAATAACAGTATAATTTTGGCTTGACTTATTTGGTAATAACGTTCTATCTGAAGGTGGAAGTAAAG CCAACGAGAACGCATTTCCA GTGTTGGTTACGAAACTTAATTGTCCGCTAGTTATATTCGGTCTTATAATTATTACATT CCCCGGACTCAAAATTACTCCATTCCTATTCAATGAACCATTGGTAAAGATTAGCAAATCTTTAACTGGAAATGTG TAA ATTTCGCCGTTAAAAGTTGTTTCAACTACGCTTTGAATGTTATATACACCCTCGGTGTCTAGTATATATACATGAGGTAT GAAGGAAATTGTTTTATTTTTTAATTCCTCTACGATCCAATAATAACCTACTTTAGCTTTACTTAATATTTCGCCATTTA TATTACTCTGAATGTTGTAGAGTTGTGTAAAATTCTCATGATTTAAGATTATTATTCCAATTAAAATAGAAAATAGCAAA ACGATCACTAGAGTTATTGCAAGTAATCCTAAACTATCTTGCATTAGTAAAAAATAGGAAAAGAGAAAATATAAACGTTT ATATCGAGAAGAATTTCAAGATTATCGGTTCTATTACGCTGAAGAAGTGTATTGAGAGCACTGCTAGGGTTAATCCAATT GCTGGCATTATCATGTATTGTACAGTGCCATATAGTGCTTTAGTTACCAGTAATCCTATGGCAAAAGTTGACATTAAAAT GAATATGAACATTTCA