SSO10891

Coordinates:2441592-2441714

>SSO10891 41 aa !not a gene!
MAEIFNTSSCSFSKSICLFDTAVDAEYIKPSSIANKILFSL

>SSO10891 41 aa !not a gene!
TTGGCTGAAATTTTTAATACATCTTCTTGTAGCTTTTCTAAGTCAATTTGTTTGTTCGATACGGCGGTTGATGCGGAGTA
TATCAAGCCATCGAGTATTGCTAATAAGATTTTGTTTTCTCTC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2441092 - 2442214 (Additional range around SSO10891 is :500nt.)

>Sulfolobus solfataricus P2 TACCAGTAGGGCCTACGAGAAATGTAAATAACTTAGCTTCTGCAATTATCCACAAGTAAACTGCCATTAAATCGCTTAAT GTCCCATACTTATATATCAAATCAATTATCGTTAGAGGTTTTTCAGGGAATTTTCTTATATTAAATGTCGTTCCCCTACT TATTTCTTCACCGTAACTCACAGCGACCCTATGTCCCTCCGGTAACATGAAATCTTGTAGTGGTGTAGCTGTACTTACAC TTCTCCCACCTAGCGATGCCAGCCTCTCTACTAATCTCCTTACCTTTAATTCGCTCCCTAAAACGATGTTAGTCTCCAAT CTAGGCCATTCACTATGTCTACTATGTACTACTGAAATTGGTGTAGTCGGAGATACTAGTTCTATCTCTTCGACGAAAGG ATCACTCATTGGTGCTTGTAATATCGAATATTTTATTTCTCTAGTGATATAGTACATATACTTCTTTAAGTTTCTCTTCA CGTCGCCTATTACTCCTAAT TTGGCTGAAATTTTTAATACATCTTCTTGTAGCTTTTCTAAGTCAATTTGTTTGTTCGA TACGGCGGTTGATGCGGAGTATATCAAGCCATCGAGTATTGCTAATAAGATTTTGTTTTCTCTC TGATCAAGTTGTGGT TCATTTACTAAGTAGAAGCCAATTCCATCCTTTTCGGCAATGTAAATTTCAACGTCAAAGCTATTTAGTGTATAATGCTC TACGATATTTCGGTTATCTAGGCTAGCTTTAAGGGATATTATTCCAGATTCATCAAGTGATTGAAGATAATAGGATAATT CTTCAAATTTATTGTGTGATTTCTTTTTACCAATAAGTACCATATACCTATTTAAAAAAATAAAAATAAAATACTTTATT GTTACTTATTGGTCGATAACTTCCACTGATGTAGCATAGGTTTGCCCATTATCGTACTTAACAAGCACAGTAATAACATA ATTATTGCCTTCTATTGCTTTAGGTACAGCTAGTGTAAAGGCATAAGAGTGACCGGGTGGTATATTTAAACTGGAATTGG TAAAGTTTGATATAACCGTAGCGTTATTTTGAGGACGCACTTGAATTGTTATGCTGGTTATATTACTAGCTCCTTGATTA ATCA