SSO10892

Coordinates:2441659-2441832

>SSO10892 58 aa !not a gene!
MMRSISSHRVLLIRFCFLSDQVVVHLLSRSQFHPFRQCKFQRQSYLVYNALRYFGYLG

>SSO10892 58 aa !not a gene!
TTGATGCGGAGTATATCAAGCCATCGAGTATTGCTAATAAGATTTTGTTTTCTCTCTGATCAAGTTGTGGTTCATTTACT
AAGTAGAAGCCAATTCCATCCTTTTCGGCAATGTAAATTTCAACGTCAAAGCTATTTAGTGTATAATGCTCTACGATATT
TCGGTTATCTAGGC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2441159 - 2442332 (Additional range around SSO10892 is :500nt.)

>Sulfolobus solfataricus P2 TAAATCGCTTAATGTCCCATACTTATATATCAAATCAATTATCGTTAGAGGTTTTTCAGGGAATTTTCTTATATTAAATG TCGTTCCCCTACTTATTTCTTCACCGTAACTCACAGCGACCCTATGTCCCTCCGGTAACATGAAATCTTGTAGTGGTGTA GCTGTACTTACACTTCTCCCACCTAGCGATGCCAGCCTCTCTACTAATCTCCTTACCTTTAATTCGCTCCCTAAAACGAT GTTAGTCTCCAATCTAGGCCATTCACTATGTCTACTATGTACTACTGAAATTGGTGTAGTCGGAGATACTAGTTCTATCT CTTCGACGAAAGGATCACTCATTGGTGCTTGTAATATCGAATATTTTATTTCTCTAGTGATATAGTACATATACTTCTTT AAGTTTCTCTTCACGTCGCCTATTACTCCTAATTTGGCTGAAATTTTTAATACATCTTCTTGTAGCTTTTCTAAGTCAAT TTGTTTGTTCGATACGGCGG TTGATGCGGAGTATATCAAGCCATCGAGTATTGCTAATAAGATTTTGTTTTCTCTCTGA TCAAGTTGTGGTTCATTTACTAAGTAGAAGCCAATTCCATCCTTTTCGGCAATGTAAATTTCAACGTCAAAGCTATTTAG TGTATAATGCTCTACGATATTTCGGTTATCTAGGC TAGCTTTAAGGGATATTATTCCAGATTCATCAAGTGATTGAAGA TAATAGGATAATTCTTCAAATTTATTGTGTGATTTCTTTTTACCAATAAGTACCATATACCTATTTAAAAAAATAAAAAT AAAATACTTTATTGTTACTTATTGGTCGATAACTTCCACTGATGTAGCATAGGTTTGCCCATTATCGTACTTAACAAGCA CAGTAATAACATAATTATTGCCTTCTATTGCTTTAGGTACAGCTAGTGTAAAGGCATAAGAGTGACCGGGTGGTATATTT AAACTGGAATTGGTAAAGTTTGATATAACCGTAGCGTTATTTTGAGGACGCACTTGAATTGTTATGCTGGTTATATTACT AGCTCCTTGATTAATCAAATCCCCAGTTAAAATTCCTCCGACCATCTGGACATTACTTATACTTAATCCAGTAGTGATCA TACTATGCCTAAGCACGCCGAAGAAGTAATAACTGATTAGGCTAACTGCTGCAAT