SSO10895

Coordinates:2443453-2443608

>SSO10895 52 aa !not a gene!
MNTSLLFQTSSLVYLRLLQLKLYIVRLQRVPLLSSLTLGICLTLIVFLILLE

>SSO10895 52 aa !not a gene!
TTGAATACCAGTTTATTGTTTCAGACAAGCTCATTGGTCTATTTAAGATTGTTGCAGCTGAAACTATATATAGTAAGACT
CCAACGAGTCCCATTATTATCCAGCCTAACCCTAGGGATCTGCTTAACCCTAATAGTATTCCTAATACTATTAGAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2442953 - 2444108 (Additional range around SSO10895 is :500nt.)

>Sulfolobus solfataricus P2 TTTTACAATAGTATGATTAACGTAAATATTAGTGATATTTATCGGTAAATTTCCAATATTTTCAACATAAAAATACGAAT GATTATTTATTTGATGGTAATATACTACACTCAAAATTTGGCCACTATCAATATAGTAATTTTTAAGTTCTTGATACAAA CCATATTGATTTGCGTTAACTATGTGTAGATAGTAGATAGTAACGATTGCAATTGCAATTAATGTAACTAAAATAAGAAA TACTACAGTTATAGCCTCAGAAATACCTCTCATTAACAGTCACTTATAATAAAGTAATGATTTACCTTATTTATAACGAT TTCTCAAGGTATTAATAAAATTAAAATTTTTACTTTCCACAAATTAGCTGATGTCTCTTACCATTAAATAGGTTAAAATT GAAGTATAAGGTATGGCGAATATATTTACTATTGGTATTAAGCTAAGTAACGATCCGATTAGTATAACTACTGCCCCGCC AGCATCTACACCAAACGCCC TTGAATACCAGTTTATTGTTTCAGACAAGCTCATTGGTCTATTTAAGATTGTTGCAGCT GAAACTATATATAGTAAGACTCCAACGAGTCCCATTATTATCCAGCCTAACCCTAGGGATCTGCTTAACCCTAATAGTAT TCCTAATACTATTAGAA TAGCAATTATAGGATATAATCTACTTAAGGTGTTCCTAGCATTTGTAAAAGCGTTATTCAAA TTGAGTTGAGCTCCCATAACTGCATCTCTAGCCATGTAAGTGGTTGTATGAACTGTTATGCTGAAAATAATCGCATCTAC AATCCCTATAATTATACTAAATATTAGAGCTGTAACTGTAAAGGCTACTGGTGAAATCAAACTTATTCCAGCAGTTATTG CACCGAAAAGCGCTAATAATATAACCTCTATTATTAACATTATTATCGGCGGAAATATAATTGAGAGGTTCTTTGTAAGG ATATTGAACGAAGTAGATAGCCTATCTGGCTGTAAGGGATTAGGAGACGTAGGTGAAGGTGTTGAGGGAGGGTTCGTAGA TATTATCGGCTGGTATTGAAGAGGATACCCACATTTACTGCAATAATTCGCGTCATCTGGATTAATATACCCGCACTTCG GACATTGTTTTGGCATTTGTAAGATAATTCTCTTCCC