SSO10905

Coordinates:2447099-2447266

>SSO10905 56 aa !not a gene!
MIQYHSRNSHIRLFQFHILGICNRNLLLLQPFFHILADEGRSITQLNLVKLSHLLL

>SSO10905 56 aa !not a gene!
TTGATCCAGTACCACAGCCGCAATAGCCATATTCGTCTATTTCAATTCCACATATTGGGCATATGTAACCGGAACCTTTT
ACTTCTTCAGCCTTTTTTCCATATATTAGCAGATGAGGGTCGAAGTATAACTCAATTAAATTTGGTAAAGCTTTCTCATC
TTCTTTTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2446599 - 2447766 (Additional range around SSO10905 is :500nt.)

>Sulfolobus solfataricus P2 ACATCTCTCAAGGTAACTACACCTATTATTTTCCCGTTTTCATTAATTGCTAATAAGTGAGTGATGTTATTCTTCATCAT AAACATAAAAGTATCTATCAAATCCTCCTCTCCATTTATAGTAATAACGTTTTTTATCATAACCTTTGATACCGGCTCAT TTTGTGAGATCCCCTTCCCAAGTGAACTTAAAATTATACTTCTAGTTACTATGCCTATGATCTCCTCTCCTTTACTATCG TCAACTATAAGCGCAAACTTGACTCCTTGTTTATCCATACGTTCTAATGCTTCGGAAAGACTAGTATGTCGGGCAATTCT TATAGGTCTAGTATTATTGAAAACATCTTTAAGTTTCATAGATTATTTTTCTCTCTCTACAACTTAAACTTTATTTATCA TTAACAATGTTTAACAATTGTGCTTTATAACAAGAAAACTTAAAAGACATATATAAAGAAATAGATCATTTTGTATAAGA AAAAAATATATAGATTAAC TTGATCCAGTACCACAGCCGCAATAGCCATATTCGTCTATTTCAATTCCACATATTGGGC ATATGTAACCGGAACCTTTTACTTCTTCAGCCTTTTTTCCATATATTAGCAGATGAGGGTCGAAGTATAACTCAATTAAA TTTGGTAAAGCTTTCTCATCTTCTTTTG TAATTTTTGTGTCAATAGCCTCTGTAATTCTAAACTTTAAAGTTTTCTTCT CTAAAGCTTTCTTAGCCAGTTGTTTAGATGAAATTTTCCCCTTAATAACTCCTCTGCGGTCAACAACTTCTATCTCTTCA TCAGTTATACGGAGTGCTATCTCCTCGACTTCCTCATCTTCATATAATCTCTTAACTTCTTGCATAGTGGTATTTATACT GTTTATAGTATTTAAACTTTTACCTTCATAACTTTCATAGAAATAAGCGCGTTACTATACAGAGAATTTTTCTTTATCGC TTAACCAATAGAACAACTAATTATATAAAAAGAAATGAAATCGAGCTATACACAACAACTCATTTTACTAACGTCACCGG TAAAAGCTAACGCTGCTATTCTTAAACTTTCTCCCATTGTGGGAAAGACATGTATTGTATCGATCAAGTCATCTATTGTA GCCCTAAATCTAAGTGCTAATGCTGCCTCATTTATCACTTCAGCTGCGT