SSO10909

Coordinates:2448746-2448961

>SSO10909 72 aa !not a gene!
MTYLPLDLRRVLDLFRIRSYPLRHQINQLTLYFRKSFHTCNSFLLLVALFREKPMGLALSYALKTLFSPRYS

>SSO10909 72 aa !not a gene!
GTGACGTACCTCCCTCTTGACCTAAGGAGAGTATTAGATCTTTTTCGAATACGATCCTATCCTTTACGCCATCAAATAAA
TCAGTTAACACTTTATTTCCGCAAGTCTTTCCACACATGTAACTCTTTCCTTCTTCTGGTAGCATTATTTCGAGAGAAGC
CCATGGGGTTAGCCCTTTCCTATGCCCTAAAAACGCTATTTTCCCCTCGCTATTCA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2448246 - 2449461 (Additional range around SSO10909 is :500nt.)

>Sulfolobus solfataricus P2 AGTAATACCGAATTTACCTTTTAAACTATACCTTTCCTTAACGGTATTCACGAAGTTCATTAGATCTTCGAAATCCTTTC CACCCCAATCCCCCACACAAGCCTTGGCGAATTCCTCCCCATATCCTTGACTGCCTCTAGGATTTGCATATATTACGTTA AACCCATTATCTACGAAGAACTGGAATTCTATGAAATAACCATAACCATACGCCATATGCGGTCCCCCATGGATGAATAA TATTGTTGGTGCGTTAGGATCTTTAATTATACTCCATCCCTCCACTTCTACTCCGTTAGAGTTTACTGTTATTCTCTCTG GAGTGTATCCTTTGATGTTAGGGTTCGGATCATATTCTATATCTCTATATTTTAATATTACAGGCTTTTCTGGAGTGGAA TAGAAGTAAGCTAGTTCACTATTACTATAATCAAATCCTCTTACCATTATATTTCCACTAGTTACCTTATCTACCTTATT ATCAGAGATTTGATAAATAT GTGACGTACCTCCCTCTTGACCTAAGGAGAGTATTAGATCTTTTTCGAATACGATCCTA TCCTTTACGCCATCAAATAAATCAGTTAACACTTTATTTCCGCAAGTCTTTCCACACATGTAACTCTTTCCTTCTTCTGG TAGCATTATTTCGAGAGAAGCCCATGGGGTTAGCCCTTTCCTATGCCCTAAAAACGCTATTTTCCCCTCGCTATTCA TA GCTATTGCTTGTACAGTCCCATCCTCCTTCGTTATTCTGTTTAACTCCCCAGTTTCTATATTTACCTCATACAAATTTCC TAATCCATAATCATCTCCGTCCTTAGTTGCTGAAATTACGACCCTATTACCGTTTGTAGCTAAATCTGTAACGTCAAAGT TCCCTGTAACGAGCCTTCTCAGATCCTTACCATCAAATAGGTAAAGTGATTGCCTAGCTCTCAATAAACCTCTGCTATCA AACCTATACTTTATCTTCTCGGCTCTAAAAGGTAATGTCTTATCTGTGTTTTCCTCTGCTATCACTAATATTCCCTTATT ATGGAACTCATATTTGGATATTTTGCCAGAAAATGTAAATATTACTTTAGGCTCGCCATAGAGTTGTGCTTCAAGTAAGG ATGATTTAGCCTCTTCGTTTCTTATAAAGTAAAGCTTATCATTATTGAACTTAGGTGATGATTCATTTCCTTGAAAAGTT ATCCTCTTGAGGTTCAA