SSO10910

Coordinates:2449652-2449789

>SSO10910 46 aa !not a gene!
MCALYNHVLVEILSSILLLYFSNWYSNIVLKYKYTLFLSNPNRASI

>SSO10910 46 aa !not a gene!
ATGTGTGCACTCTATAACCACGTATTGGTGGAAATATTATCTAGCATCCTTCTTCTCTATTTTAGTAATTGGTATAGTAA
TATCGTCCTTAAATATAAATATACCCTATTTCTTTCTAATCCAAATAGGGCTAGTATT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2449152 - 2450289 (Additional range around SSO10910 is :500nt.)

>Sulfolobus solfataricus P2 ACCATCAAATAGGTAAAGTGATTGCCTAGCTCTCAATAAACCTCTGCTATCAAACCTATACTTTATCTTCTCGGCTCTAA AAGGTAATGTCTTATCTGTGTTTTCCTCTGCTATCACTAATATTCCCTTATTATGGAACTCATATTTGGATATTTTGCCA GAAAATGTAAATATTACTTTAGGCTCGCCATAGAGTTGTGCTTCAAGTAAGGATGATTTAGCCTCTTCGTTTCTTATAAA GTAAAGCTTATCATTATTGAACTTAGGTGATGATTCATTTCCTTGAAAAGTTATCCTCTTGAGGTTCAAATAAATTGATG ATTTGTATTTATCCTCTTCTATCCATGTCTCTACGTGAAATAGTTTTCCATTCTCTATTGTTATTTCTGGTACTAATTTA ATCGAATAGTAGTAGTCTTCTGGTTTCATAATATTAGTATATTGCTCTAAGTAATAACTTTGATTATCTTATCGTTTTAT AAACTTTTAGAGCGAGTAAT ATGTGTGCACTCTATAACCACGTATTGGTGGAAATATTATCTAGCATCCTTCTTCTCTA TTTTAGTAATTGGTATAGTAATATCGTCCTTAAATATAAATATACCCTATTTCTTTCTAATCCAAATAGGGCTAGTATT TAGTCTCTGGTACCTCATTTCTCCAATTATAATGATCCTTGTATTTAAGATGAGAAGAGCTCCTCAAGATGTTACCTTTA TGGTAGAAGATCTTTCAAAGAAATATAACGTTAAACTGTCCAAAGTTTACATTATAAATGATAATTTCCTTAACGCTTTT GCCTTTGGCAATATAATTTTTAGAGGAATAGCAGTTACTTCACCACTGTATGAAAGTCTAGTCCAAGAGGAGTTAGCGGC AGTTCTCTCTCATGAAATTGCCCATATAAAGAATTACGATCCAGAAGTTATGTTACTTACAATATTTTCCATTAATTCCA TTTATGCAGCGCTTATTTATTATCTGCCTTTAGTTTCCCTATTTTTCCTAATAATATACTTTGTCATCTTATTGCCATCA GTCTTTTACGTGCATAGGAAAATAGAAAAGAGGGCTGATTTAACTGCAGTAAAGGTGAATCCTGATATAACTTATTGGTT GGAGAGTTCCCTAATAAAA