SSO10936

Coordinates:2458851-2459036

>SSO10936 62 aa !not a gene!
MSYPNISFLINCHPVRISRLISEIYCNSSIIDLPFIQIEIKYEDLSNWTINEEHLSIIWIPT

>SSO10936 62 aa !not a gene!
ATGAGCTACCCAAATATATCCTTCCTCATCAACTGCCATCCCGTCAGGATTTCCCGGCTCATTTCCGAAATCTACTGCAA
CTCTTCTATTATAGATCTCCCCTTTATTCAGATCGAAATCAAATACGAAGACCTTTCTAACTGGACTATCAATGAGGAAC
ATTTGAGTATTATCTGGATCCCAACC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2458351 - 2459536 (Additional range around SSO10936 is :500nt.)

>Sulfolobus solfataricus P2 TTGCACCTAACATTGCCAATTCCTCTAGAACTATAGCTATTGAAGGACCTCCTATTCCATGAGTCGCTATACTTACGGTT TCACCATTATATTTACCTGTATATACAAGGAATCCCCTATTTTCATTGGTTAACTTAGGATTTTGCAATAATGTCGATAA TAGTCTTGCTCTGCCTGGGTCTCCGACTACTAGAACTCTTTCTGCAACTTCCCCCTTTTTAGCCAAAATGTGAACTGGAT TCATAATGAAAAATAACGTTTAAGGATATAAAACTTACGAGATTTTAAACCTAAAATTTTGCAATCCTCTTACATTAGCT TTAGTTGTAAACGTTTTTCCAGCTAATGGGTCTTGGCTTTTTCCAGCAGTGGTAATGAATAATTGGTCTAGTTCTTGAGT ACCGAAAGTTACTGAGGTTACATAGGTTGCGGGCACTTTTATTTCAAACAATTTCTTCCCGGTTTTAGGATTCCATCTAC TAACCTTTCCTCCACCCCA ATGAGCTACCCAAATATATCCTTCCTCATCAACTGCCATCCCGTCAGGATTTCCCGGCTC ATTTCCGAAATCTACTGCAACTCTTCTATTATAGATCTCCCCTTTATTCAGATCGAAATCAAATACGAAGACCTTTCTAA CTGGACTATCAATGAGGAACATTTGAGTATTATCTGGATCCCAACC TAAGCCATTTGATACTGTGAGACCTTCTAAAAT CTTAGTTATCTTACCAGTATCAAGTTTATAGAAACTTCCAGTTGGTTTTCTTTCATTCATATTCATAGTTCCCGCCCAAT ATCGCCCAAGTTTATCACACTTCCCATCGTTAAATCTATTAGATTCCATATCAGTTTCCACTTCAGCAATCTTCTGAATT TCTCCTCTGTCTAAATTTACTATATAAAATCCATGTCTAATGGTAGCAATCACTCTCTTATCATCAATAACACATAAGGA TGATATGAGATCAGGCATCTCATAGAATACTTCAGTACCAGTATTCAGATCGTTAACTATTATCCTCTTTCCCTCAATAT CAACCCAAAAAAGTTTATTCAACTCCTTATCGTAAACGGGGCCCTCTCCTAAAGTCGCCTTGTAATTACTTAAGGTAATT AAATTCGGCTCCATGCCTTAGTATTTTAGTATAATTAGCTTTTAATCCTTTTTATCATCTGAGGAGT