SSO10948

Coordinates:2463795-2463947

>SSO10948 51 aa !not a gene!
MGSLQTLSNTLVTYSINYTQMFKLKLSNIHLASTFRKNLRHLKLIPPNMIL

>SSO10948 51 aa !not a gene!
GTGGGCAGTCTGCAAACTTTATCCAATACGCTGGTAACTTATTCCATCAACTACACCCAAATGTTCAAGTTGAAGTTATC
CAATATCCATTTAGCGAGTACATTCAGAAAGAACTTACGGCACTTGAAGCTCATTCCTCCCAATATGATATTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2463295 - 2464447 (Additional range around SSO10948 is :500nt.)

>Sulfolobus solfataricus P2 CGTGTCTCTCATATCCATTTGCGACGGAAGATGAGCAGAGGGACGCAATTAATTCATACGATGGAAAGGGTATTCCAGAT TTTAAAGTACCTGAATATTGTAAAGCAGGGATGCGAGTAAAGCATATTATGAACCAAATTATTACTGATTTAACTAACAA ATTGGGCAGACCACCTACTCCGAGAGAGCTATATAATGAGTTAAAATCAAGATATTATAAAAATGAGGAAACCACCAGTA AATGAACTGATGATTAAACCTTCAGTGGGCTGATTTTAACTAGGATATTTTTAAAAGTAGAAATTCACTATATTTAGTAG ATATGAAAGCCCTTTCAACTCTTGCAATGGCTGTAATAATAATAGTTGTAATAGCTGTAGTGGCTGCTGCAGCATATCTG ATTACCTCAAGTAGTCATCATCCCTCTATTTCAACGACAACTACACCGATTATAGCTACCAACACAACCGCACCAATTAC ATTAACAGTAGTCACATTTA GTGGGCAGTCTGCAAACTTTATCCAATACGCTGGTAACTTATTCCATCAACTACACCCA AATGTTCAAGTTGAAGTTATCCAATATCCATTTAGCGAGTACATTCAGAAAGAACTTACGGCACTTGAAGCTCATTCCTC CCAATATGATATTA TAGGCTTCACTTCAACTTCTGCTCTAGATGTCGCATCATATTTGTTGCCTATAAACGAGTCAGTT TTCAATTTCTCCGACATAATATACCCTCAAGAAGATTTTGGAGGATTGTATTATAACGTATCCACTAATAAAACTGAAGT GATAGGTATCGCATATGAAACTGCAGTTTACTTAATGGCATATAATGCTACAATATTTAATAATCAAACCTTGGCACAAG AATTTGAACAAGAGTATCATATGAATTTTTCACCAATTACATATAAGAACTGGAGTGTAGTTTTAGATGTTGATCAATTC CTAACTTCACACCATATCACAAAATACGGTTTCCTAATAGACGATCATGTCGCACACGGAATTATTGACGCATTTCCTGC AGTATTTGGCTGGTATTATTTTAGAAATAATTCATTAAATATGGGTAATCCAGCAGGTTTACCTAACTATAACATAATGT TTGAGGGTAGAATATTACCAGGTTTTAATTATCC