SSO10960

Coordinates:2469308-2469481

>SSO10960 58 aa !not a gene!
MEFKKSSLLYIIEPLIITSFLTIISLFKLICSLSNPVIINSDLAIEFLRIDWASTILS

>SSO10960 58 aa !not a gene!
ATGGAATTTAAAAAATCATCTTTACTATATATTATTGAACCTCTAATTATTACTTCATTTCTAACTATAATATCTCTATT
TAAACTGATCTGTTCATTATCTAATCCGGTAATTATTAACTCAGATCTAGCTATAGAATTTTTGAGAATTGACTGGGCTA
GTACCATACTCTCT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2468808 - 2469981 (Additional range around SSO10960 is :500nt.)

>Sulfolobus solfataricus P2 TATTTAATTGTAGGAATTAGTGCAATTACTGGTATAGGCTCTGCGATGTTTTGGCCGTCCAACTCAACTGCTATAATGTT TCATGCACCTAAAGAATATTACGGTTCGGTCTCGGGTTTATCCAGAACGTTAGGGAATATAGGTACTATTCTAAGTTACG TTTTAAGTATAGTAGTTGCAACTTTAAGTATACCCAGAAGTGTTGCCTTTGAGATATTCATAGGAACTACCACGTTGAAT GGGGACGTCAGTGTAACGTTTGTTAATGGATTACATTTTGCTTTTCTCATATCTTCGATTATAATAGTAGTAGCTATGAT ATTCTCTTTTATGAGTGGGAAAACTCAAGAAAGTGCCATCAAATAGAATCCATTTTTATTAGTACTTTTATGTTAGGTAG TTCTATTACATATTTTCTGAACCACTCGTTAATATTGTCTATATAACCTACCTTATCCACTATTTTGTTAAATTTTTCTT GATTTTCACTAACTATCTTT ATGGAATTTAAAAAATCATCTTTACTATATATTATTGAACCTCTAATTATTACTTCATT TCTAACTATAATATCTCTATTTAAACTGATCTGTTCATTATCTAATCCGGTAATTATTAACTCAGATCTAGCTATAGAAT TTTTGAGAATTGACTGGGCTAGTACCATACTCTCT TGATTATTTATAGTATCTATCACTGCAACTCTGTCATCAAATTT TAATTCCTTAGTTGTTCTAAAGCCCTTCTCCTTAAGGATTTCTTCCTTTCTACTATCCTTCTCTATAACGAAAGTTTCTA ATCCATTTATTTCAGCTACTATTGAAACCAGAGTTCCAGTGCTACCGCCTCCTATTATTATTACCTTCTCTATCTCTTTG TCTATCTTATTTAACGCAGCAACAGCAACTGCCGTAGGTTCTACTAAAGCTCCTAATTTCAAATCTAAGGTGTAGGGTAT TCTAAACACGAAATCTTTAGGTACGTTGATATATTCCGCCATTCCGCCATCAGCATTAACTCCAATTGATATTTTATTTT TACAACTGTTATAAAATCCTCTTCTACAATTATTACAGTAACCGCACCAATAATTTGGGAAAATAGCTACCTTCTCCCCT TTTTCAGTTATCCCGGATATTTCATGTCCTAAGACAAGTGGTTCCTTAACTGGCT