SSO10961

Coordinates:2470022-2470147

>SSO10961 42 aa !not a gene!
MYLGKTFTSFGLGSSSLTFSLTKFPLIKNTFHNLSSPLFAYS

>SSO10961 42 aa !not a gene!
ATGTATTTAGGAAAAACCTTTACTTCATTCGGTTTAGGAAGCTCATCTCTAACATTTTCTTTAACGAAATTTCCATTAAT
AAAAAATACCTTCCACAATCTTAGCTCACCTTTATTTGCCTATAGT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2469522 - 2470647 (Additional range around SSO10961 is :500nt.)

>Sulfolobus solfataricus P2 ATTTTAATTCCTTAGTTGTTCTAAAGCCCTTCTCCTTAAGGATTTCTTCCTTTCTACTATCCTTCTCTATAACGAAAGTT TCTAATCCATTTATTTCAGCTACTATTGAAACCAGAGTTCCAGTGCTACCGCCTCCTATTATTATTACCTTCTCTATCTC TTTGTCTATCTTATTTAACGCAGCAACAGCAACTGCCGTAGGTTCTACTAAAGCTCCTAATTTCAAATCTAAGGTGTAGG GTATTCTAAACACGAAATCTTTAGGTACGTTGATATATTCCGCCATTCCGCCATCAGCATTAACTCCAATTGATATTTTA TTTTTACAACTGTTATAAAATCCTCTTCTACAATTATTACAGTAACCGCACCAATAATTTGGGAAAATAGCTACCTTCTC CCCTTTTTCAGTTATCCCGGATATTTCATGTCCTAAGACAAGTGGTTCCTTAACTGGCTTTTTACCTAAATAAATATTCT TATCAGTACCACATATTCCT ATGTATTTAGGAAAAACCTTTACTTCATTCGGTTTAGGAAGCTCATCTCTAACATTTTC TTTAACGAAATTTCCATTAATAAAAAATACCTTCCACAATCTTAGCTCACCTTTATTTGCCTATAGT TAGTTATTATTA CTGTTCCGATGAAGTATATAAGACCTATCCCAATTAAGATTTCCATTCCTAAGAGATATGCTTTGGTGACTTCCACAGTA GCACCAAATACTATTGGTACTATTATACCCCATAGAGTTTCCCAAAAGCCAATATGACCACCAAATTGACCAGCTAATTC AGTAGAAACTAGAAAGGATGGTGCTGCCCATTGTATCCCCGACCATCTTAGGAAGAAGAAAGTTACCATTAGTATTTCAA CTGCTTCTATCGGTGAAGAAATGAGAGTAGCAGCTGCAAGACCTATAGTTACTGCCAAAGAGCTAACCGCAAATCCTACT TTGAAACCTAAATTGGGATTTCTCTTAATTAATTTGTCAACGACATAACCTCCTACTAACTCTCCTATGAAGCCAAAGCT CCAAATCAATGCAGTGTATTCTAATGTAAACGATAGAGAAAGATGTCTAGCGTAAAAAAGATATAAAGGCAACCAAGTAA ATAGACC