SSO10966

Coordinates:2472602-2472823

>SSO10966 74 aa !not a gene!
MPTLEIFVIYCASCPAQLYINLYLMLNSLHALSITLMTSSEKLTGLAVHRCLYSTSSFSSSAILFAILTNSFIV

>SSO10966 74 aa !not a gene!
ATGCCGACTTTAGAAATCTTCGTCATATACTGTGCATCATGCCCTGCCCAACTATACATAAACTTATATCTCATGCTTAA
CTCTTTACACGCTCTTTCTATAACACTAATGACTTCGTCGGAAAAACTCACAGGATTAGCTGTCCACAGATGCCTATATT
CAACTTCTAGTTTCTCGTCGTCGGCAATACTTTTTGCAATATTAACAAATTCATTTATAGTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2472102 - 2473323 (Additional range around SSO10966 is :500nt.)

>Sulfolobus solfataricus P2 CCTAGGCATAACCTTAAGTAAAGCTTTTGTAGCCTTAACTCTAATATCCGCACCGAATGAGGGATTAATATACTGTAACC TATCAAGCTGTTCCTTTATACTGTTTATAACCCTTTCATTTCCATATCCCAAATTTACATTAACGAATTGCGATGAAAAG TCTAAATATTTCTTTCCCTCCACATCATAAAAGTAGACTCCCTTTGCACTTGATACGATTATGGGATCCCATCCCTTTTG TTTACTCCACGTTTTGAAAGTATGATCCCTAATAATTTTCTTATCTTCTATTTCTCCCATATTCTATCTTATTTTTATAA GCAAGGGTTATAAGCTTTTTACACAGATGATTAAAATTAGTACAAAAATTGAATATAATCATCAACTGTTTAAAAGTTCT ACAGCTTTCTCTAGTACTCTTAGCCCGTTTAACATATCCTCATCTGAGGAGTATTCTTCCTTTGCGTGACTAATGCCTAA ATGAGATGGAATAAATATC ATGCCGACTTTAGAAATCTTCGTCATATACTGTGCATCATGCCCTGCCCAACTATACATA AACTTATATCTCATGCTTAACTCTTTACACGCTCTTTCTATAACACTAATGACTTCGTCGGAAAAACTCACAGGATTAGC TGTCCACAGATGCCTATATTCAACTTCTAGTTTCTCGTCGTCGGCAATACTTTTTGCAATATTAACAAATTCATTTATAG TG TGATCTATTCTATTCCTCTCAATACTCCTAACGTCAACAGTGAGTCTGACTTCCCTAGGTATAGCGTTGTATACATT TGGTTTAACATTAAGTATACCAACAGTGGCCCTTAAGTTTTCCTGCTTCTTTGCGTGATCCCTAACGCTAACTACGAATT TAGATGCGCCTACTAGGGCATCCCTTCTCCTATCCATTGGTGTAGGTCCGGTTTGACTAGACTGACCCTTAAATGTGAAT TCATATACGCTTAAACCAGCAATTCCTAAAGGTATTCCAATTTGATACCCCTCTTCCTCTAAAATTGGACCTTGTTCTAT GTGAAGCTCTAGATAGTAGTTAGGCTTCATATGCATTAGTCTATTGCTTTCATCTCCCATAAATCCGGAAACCCTTAACG CTTCCTCAAAACTTATATTATCCTTATCTCTCCTTGAGTAGACGTAGTTTTTATCGAAGATACCTGTGGTTAATCCCGAG CCTAGAAGTGAGGGTTGAAATCT