SSO10977

Coordinates:2475217-2475345

>SSO10977 43 aa !not a gene!
MAIVADTMLKIRPKDLLLNAFTSSTGTPITYLNCDINLRTSTV

>SSO10977 43 aa !not a gene!
GTGGCAATAGTAGCTGATACTATGCTCAAAATTCGACCGAAAGATTTATTACTGAACGCCTTCACGTCCTCCACGGGAAC
TCCGATCACGTACTTGAACTGCGATATAAACTTGAGGACTTCTACAGTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2474717 - 2475845 (Additional range around SSO10977 is :500nt.)

>Sulfolobus solfataricus P2 ACTACGTGAGATTCAAGTCCTAGCGAGGACACTACTTCAAACACGAGAAGAGTTGAAGGAGGTGAGGAAAATGATAGAGG GTAATGTGCCTCAAGACCACGTGTTACTCACGATTCCCGGAATAGGGAAACTGGCAGCTGGGATTATAATTGGGATTGTG GGTGATATTAAGCGCTTCCCAAGACCTGAATCCTTCGTTGCTTATTGCGGTTTAGACCCGGTGGTTGAGAGGAGTGGTAG GATTGAGGTTAGAAAGGGTATCTCCAAGAGGGGTAACAAGTATTTGGGTAGCTTGTTTTATTTCCTTGCCGAGACTCAAT ATTCGCGTAACCCTACTCTCCTTAAGTTCCACGAAGCTCACAAGGATAAACTGAAGGGTAGGAAACTGTACACTGCCTTA GCTAGGAAGTTGGCTAGGATTGTGTGGAGTGTTTGGTATAATAATAAACCTTATGAGGTGACGTGACCCTCCCCTATCAC GCGGATTGAAAGAGTCCGC GTGGCAATAGTAGCTGATACTATGCTCAAAATTCGACCGAAAGATTTATTACTGAACGCC TTCACGTCCTCCACGGGAACTCCGATCACGTACTTGAACTGCGATATAAACTTGAGGACTTCTACAGTG TAGAAGCCCG TGTCCAGGGTTACGAGCCTCACCTTGAAGCCCATTCCCGTAATTTACTCCATGAGGAACTTCACGATCTCGTCCTTGGTC ATCCCGTTAACTTGGGGAACGAAGACCAGGAAGAGCACCATTCCCTTGTACTTCGTGGTGGCAGTGGCGTAGTTATACGA GTTCCCCTTGGCCGAACTACCTAGTCCCTTCACCGGCTTACCGTACCACGTCTTGGTTGTCCAGTCTATGGAGATGTCTA CTTCCTTCACTCCCTTGAGCATCTCCATGGAAATTCTTCTCATGGACTCCAGGAGTTTCTCGATTACCCCATTTCCCTGC TCTTTCACTAGTGCTTTCAGAAAGTTTATAGCTTTAGACAAAGGATATACCACTAGATCATAGTCTAAGAACTTTTCCAA AATACTAACGTAGTTCCTCACGGTTTGTGGTGATACGTTGTACCCTTTGGATCTGCCCTCTACAGAGTCGTTCCACAAGC ACGCGGAGAC