SSO10981

Coordinates:2476361-2476483

>SSO10981 41 aa !not a gene!
MNIFTMFSPTVGARHAFTRRLGFSYEVDHFSPAEENITLPS

>SSO10981 41 aa !not a gene!
GTGAATATTTTCACAATGTTCAGTCCGACTGTAGGGGCTCGTCACGCCTTCACCCGAAGACTTGGCTTCAGTTACGAGGT
CGACCATTTTTCCCCAGCTGAGGAGAATATTACTCTCCCCAGC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2475861 - 2476983 (Additional range around SSO10981 is :500nt.)

>Sulfolobus solfataricus P2 CCAGTTGATACAGTTTTACGTCAGAGAAGTCTCCCTTAGAGAACTTCTCCAATCTCTCCTCGCTCAACTTCTCCTCGTCG CTCACGAGGAAGAGAGCTCTCCTTAACCTGTTCTCTTGTTTCGTTTGCACATCATTCATGAAGAGGTAGAGTGATACTAA CTCTTTCAAGGGGTTGTTAACGTATTCTCTAGCCTTATTTACCATGTTTTCAAGTTTTTCTGCGTCGTAAAAATCTGTTT TCTTTCCCCTTACGTCCTTTTCTTTCCATAGCAAGGCTGACTAGTAGGACTTTCACTCCTCTTTCTTTGAAGTATTGGCA AGGTCTCGTTGAGTATACTCCGGTGGGTTCTATTACGATGATGTTTGGCTTCATGGTTAGTATTTCTTCGTAGCCCTTCT CGTTGTTTGTGAACTTTCTCACCCTCCCCTTACTTGTTACCAAGTGTTCTTTTGATACGTCTATTCCAATTACCCCTACC CTTGTGTCACACCTATATTC GTGAATATTTTCACAATGTTCAGTCCGACTGTAGGGGCTCGTCACGCCTTCACCCGAAG ACTTGGCTTCAGTTACGAGGTCGACCATTTTTCCCCAGCTGAGGAGAATATTACTCTCCCCAGC TAATTAACCTATATA TAAGTCTACGAGGAGTTCGACGGAGAGTACACTACCAACAGCAAGAGACATAAGAAGGAAGAGCAGGTTAATTTCAGACT TCTGGTATATGGTAAGGAAATCGTTAAGAAGAAGAGGAAGGCCGTGATGTATTTCGCAAGAGCAACCAACCTCGACTTGA CCAAGAGGGAAGTGCTGGAGCTTTACAACAAGGTTAGGGGTCCCATTGAGACGTCTTACAAGAATATCAAGACCTTCCTT CCCTTCACGAGCTCCACCAAGTTCGTCTTTCGCGAGTTGATCTTCGTACTGGCCATGGTCTTCTACTCGCTTTACACCGT GTTCAAGGACGTCATGAGAAGAGAGGAGTTTAGATTGCTTTCATCCTCTGTTTTCTAGATGATCTATCGGATCTTGAGGA TTTTCTAGTTAAACTTGAGAAGACACTTAATAACAAGATAGATTTATTTTTACGGAGGTGATTTTGGGTCTACCGGTTAC GGTA