SSO10994

Coordinates:2479702-2479824

>SSO10994 41 aa !not a gene!
MVEISGIWNFSFTSANLSGIILSNAHANRYLVKEITKGGLL

>SSO10994 41 aa !not a gene!
ATGGTTGAAATTAGTGGTATATGGAACTTTTCATTTACATCAGCTAACCTCTCTGGCATTATCCTATCAAACGCCCATGC
AAACAGATATCTGGTTAAGGAGATAACTAAGGGTGGATTGCTG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2479202 - 2480324 (Additional range around SSO10994 is :500nt.)

>Sulfolobus solfataricus P2 AAATAGTCCCACAAGTGTTAGACTCTGATTAACTTGTATTTAAAATTAAATATCAAAAAAGAAGATGAAAAAGATAAAGA AAAGAGTTAACTTATTCCGGCGGTATTTCCTCAAAAATTAAGTTCATATGTATCCCTCTTTTCTTATTAATGATGTAAGA GATAGCGTAAATCATAATTCCGCTTGTATATATTATTACTAATGAAAGTATTGTGGGGAAGTTTATTGGTAGCAATACAG GGTTTCCCCAAGTTTGATATAACGCAAAAAGAAGGAATCCAAACTCAGGAAATCCTATCAGAGATACTAGGGGGATTCCA CTTATATTTTTGATATGCACGACCTTGTTGAAGAAGTTCTTCTTCACGAAAGGTGATAATGCAGTAGTTAGGGCGAAGAT TCCATAGCTTATTTCGAATATTACTGTTACATCTACAATTGATATTACTGTTACATATGCGTAAAGTAGTACTCCTATTA AACCAACAATTACAGTAATT ATGGTTGAAATTAGTGGTATATGGAACTTTTCATTTACATCAGCTAACCTCTCTGGCAT TATCCTATCAAACGCCCATGCAAACAGATATCTGGTTAAGGAGATAACTAAGGGTGGATTGCTG TAGAAATTAGGTAAC CAGAAGGCTATCCACATTACAATGTATAATAATATACTATGGTTTACTAATAAGGCGAAAAAAGGGGTGAATGTACCCAT ACTACTTAGATCATTATAAACTGTGCTATTTAACGAATTTGTGGAAATGTATGACCAAGACGTTAAGAATCTCTCACCAA AGGCATGAAGATTAAGGGAGGTAAATAGAATATAATAGACTCCTATGAATAGTACTGCAATGATTATACCTAGTAGTGAA TTATACTTTACTTTCTTCATCTCTCCGCTCCAAGATGCTGGTAAATTATACCATACGTAATAATACCATACTACTGGAAT TGCTAGTAATGCTCCATAAAATGGAGATACAAAATTTAAGCCGTTTGAAGTAGCAGTGGATATCACTTCGTTATACGCAT TACTTACCCCAGTAAAAGATGATAACGCATCAGAGAATTGTGAAGGAGTTATTAACGCTAAAGCCACGAATGTTACTATT GTTG